KEGG   Halovivax ruber: Halru_3123Help
Entry
Halru_3123        CDS       T02402                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hru  Halovivax ruber
Brite
KEGG Orthology (KO) [BR:hru00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Halru_3123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGB17689
UniProt: L0IG01
Position
complement(3155781..3156968)
Genome map
AA seq 395 aa AA seqDB search
MVDIVTLGTFLVAAGASLFMAWSIGAGSSGSTPFAPAVGANAISVMRAGFLVGLLGISGA
ILQGQNVSEAMGRDLIAGVSLSPAAATLALSIAAALVAAGVFTGYPIATAFTATGSVIGV
GLALGGDPAWAKYTEIGAMWILTPFVGGFAAYLIARSLRDEPISERTLVALLGVLVGVIV
ANIEFAVLGEGTAAASIAAAAGEPIPGPAAVGPILVTVAVAVLWAVPITIGMRADPLRTE
RRFLLVMGGLVAFSAGGSQVGLAVGPLVPLSEDVGLPLVALLAGGGVGLLIGSWTGAPRM
IKAISQDYSSLGPRRSIAALIPSFALAQAAVLFGIPVSFNEIVVSSIIGSGFAAAGSGGV
SVRKIGFTILAWILSFLGALAVGFGGFSAFQFVVG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatcgtcacgctggggacgttcctcgtcgccgctggcgccagcctcttcatg
gcctggtcgatcggtgctggctccagcgggtcgacaccgttcgcaccggcggtcggcgcg
aacgcgatttcggtgatgcgagctggttttctcgtcgggttgctcggcatctccggggcg
attctccagggacagaacgtctccgaggcgatgggtcgggatctcatcgccggcgtctca
ctctcgccggcggcggcgacgctcgcgctctcgatcgctgccgctctcgtcgcagccggg
gtcttcaccggctacccgatcgcgactgccttcacggccaccggctcggtgatcggcgtc
ggtctggcgctgggcggcgatcccgcctgggcgaagtacaccgagatcggggcgatgtgg
atactcactccgttcgtcggcggcttcgccgcgtacctcatcgcccggtcgttgcgtgac
gagccgatctccgagcggacgctcgtcgccctgctcggggtgctggtcggtgtcatcgtc
gccaacatcgagttcgcggttctcggtgaggggaccgccgcggcctcgatcgccgcggcg
gccggggagccgatccccggtcccgccgcagtcggcccgatactggtaacggtcgccgtc
gcagtgctctgggccgtcccgatcacgatcggcatgcgcgcagaccccctcagaaccgaa
cgtcggttcctcctcgtcatgggcggcctcgtcgccttctccgccggcggcagtcaggtc
gggctggcggtcggtccgctcgtccccttgagcgaggacgtcggcctcccgctcgtcgcc
ctgctcgccggcggcggcgtggggctgttgatcggctcgtggaccggcgcccctcggatg
atcaaggcgatctcgcaggactactcctcgctcggtccgcgccgttcgatcgcggcgctc
atcccgtcgttcgctctcgctcaggccgccgtcctgttcggtatccccgtctccttcaac
gaaatcgtggtcagctccatcatcggcagcgggttcgccgcagccggctctgggggcgtc
agcgtccggaagatcggctttacgatcctcgcgtggatcctctcctttctcggggcgctc
gccgtcggcttcggcggcttcagcgcgttccagttcgtcgtcggctag

DBGET integrated database retrieval system