KEGG   Homo sapiens (human): 1109
Entry
1109              CDS       T01001                                 

Symbol
AKR1C4, 3-alpha-HSD, C11, CDR, CHDR, DD-4, DD4, HAKRA
Name
(RefSeq) aldo-keto reductase family 1 member C4
  KO
K00037  3alpha-hydroxysteroid 3-dehydrogenase / chlordecone reductase [EC:1.1.1.50 1.1.1.357 1.1.1.225]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa05208  Chemical carcinogenesis - reactive oxygen species
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Network
nt06022  Bile acid biosynthesis
nt06226  KEAP1-NRF2 signaling
nt06251  CYP-mediated ROS formation
  Element
N00805  Bile acid biosynthesis
N00806  ACOX2 deficiency in bile acid biosynthesis
N00807  AMACR deficiency in bile acid biosynthesis
N00808  CYP27A1 deficiency in bile acid biosynthesis
N01401  Benzo[a]pyrenre to CYP-mediated metabolism
N01413  Metals to KEAP1-NRF2 signalig pathway
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    1109 (AKR1C4)
   00140 Steroid hormone biosynthesis
    1109 (AKR1C4)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1109 (AKR1C4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.50  3alpha-hydroxysteroid 3-dehydrogenase (Si-specific)
     1109 (AKR1C4)
    1.1.1.225  chlordecone reductase
     1109 (AKR1C4)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     1109 (AKR1C4)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 1109
NCBI-ProteinID: NP_001809
OMIM: 600451
HGNC: 387
Ensembl: ENSG00000198610
Vega: OTTHUMG00000017591
Pharos: P17516(Tbio)
UniProt: P17516
Structure
PDB: 
2FVL

Position
10p15.1
AA seq 323 aa
MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPM
ALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKP
GLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPV
LCALAKKHKQTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLN
RNYRYVVMDFLMDHPDYPFSDEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atggatcccaaatatcagcgtgtagagctaaatgatggtcacttcatgcccgtattggga
tttggcacctatgcacctccagaggttccgaggaacagagctgtagaggtcaccaaatta
gcaatagaagctggcttccgccatattgattctgcttatttatacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggtgcactttctttcaaccacagatggtccaaccagccttggaa
agctcactgaaaaaacttcaactggactatgttgacctctatcttcttcatttcccaatg
gctctcaagccaggtgagacgccactaccaaaagatgaaaatggaaaagtaatattcgac
acagtggatctctctgccacatgggaggtcatggagaagtgtaaggatgcaggattggcc
aagtccatcggggtgtcaaacttcaactgcaggcagctggagatgatcctcaacaagcca
ggactcaagtacaagcctgtctgcaaccaggtagaatgtcatccttacctcaaccagagc
aaactgctggatttctgcaagtcaaaagacattgttctggttgcccacagtgctctggga
acccaacgacataaactatgggtggacccaaactccccagttcttttggaggacccagtt
ctttgtgccttagcaaagaaacacaaacaaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcggatcagagagaac
atccaggtttttgaattccagttgacatcagaggatatgaaagttctagatggtctaaac
agaaattatcgatatgttgtcatggattttcttatggaccatcctgattatccattttca
gatgaatattag

KEGG   Homo sapiens (human): 1645
Entry
1645              CDS       T01001                                 

Symbol
AKR1C1, 2-ALPHA-HSD, 20-ALPHA-HSD, C9, DD1, DD1/DD2, DDH, DDH1, H-37, HAKRC, HBAB, MBAB
Name
(RefSeq) aldo-keto reductase family 1 member C1
  KO
K00212  20alpha/3alpha-hydroxysteroid dehydrogenase / dihydrodiol dehydrogenase [EC:1.1.1.149 1.1.1.357 1.3.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa01100  Metabolic pathways
hsa05208  Chemical carcinogenesis - reactive oxygen species
Network
nt06226  KEAP1-NRF2 signaling
nt06251  CYP-mediated ROS formation
  Element
N01401  Benzo[a]pyrenre to CYP-mediated metabolism
N01413  Metals to KEAP1-NRF2 signalig pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1645 (AKR1C1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1645 (AKR1C1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1645 (AKR1C1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.149  20alpha-hydroxysteroid dehydrogenase
     1645 (AKR1C1)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     1645 (AKR1C1)
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.20  trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
     1645 (AKR1C1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 1645
NCBI-ProteinID: NP_001344
OMIM: 600449
HGNC: 384
Ensembl: ENSG00000187134
Vega: OTTHUMG00000017580
Pharos: Q04828(Tchem)
UniProt: Q04828
Structure
PDB: 

Position
10p15.1
AA seq 323 aa
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atggattcgaaatatcagtgtgtgaagctgaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcgcctgcagaggttcctaaaagtaaagctttagaggccaccaaattg
gcaattgaagctggcttccgccatattgattctgctcatttatacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggtgcaattcccatcgaccagagttggtccgaccagccttggaa
aggtcactgaaaaatcttcaattggattatgttgacctctaccttattcattttccagtg
tctgtaaagccaggtgaggaagtgatcccaaaagatgaaaatggaaaaatactatttgac
acagtggatctctgtgccacatgggaggccgtggagaagtgtaaagatgcaggattggcc
aagtccatcggggtgtccaacttcaaccgcaggcagctggagatgatcctcaacaagcca
gggctcaagtacaagcctgtctgcaaccaggtggaatgtcatccttacttcaaccagaga
aaactgctggatttctgcaagtcaaaagacattgttctggttgcctatagtgctctggga
tcccaccgagaagaaccatgggtggacccgaactccccggtgctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctacagcgtggggttgtggtcctggccaagagctacaatgagcagcgcatcagacagaac
gtgcaggtgtttgaattccagttgacttcagaggagatgaaagccatagatggcctaaac
agaaatgtgcgatatttgacccttgatatttttgctggcccccctaattatccattttct
gatgaatattaa

KEGG   Homo sapiens (human): 1646
Entry
1646              CDS       T01001                                 

Symbol
AKR1C2, AKR1C-pseudo, BABP, DD, DD-2, DD/BABP, DD2, DDH2, HAKRD, HBAB, MCDR2, SRXY8, TDD
Name
(RefSeq) aldo-keto reductase family 1 member C2
  KO
K00089  3alpha-hydroxysteroid 3-dehydrogenase [EC:1.1.1.213 1.1.1.357]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa05204  Chemical carcinogenesis - DNA adducts
hsa05208  Chemical carcinogenesis - reactive oxygen species
Network
nt06226  KEAP1-NRF2 signaling
nt06250  DNA adduct formation
nt06251  CYP-mediated ROS formation
  Element
N01381  NNK to DNA adducts
N01382  NNK to DNA adducts
N01401  Benzo[a]pyrenre to CYP-mediated metabolism
N01413  Metals to KEAP1-NRF2 signalig pathway
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1646 (AKR1C2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    1646 (AKR1C2)
   05208 Chemical carcinogenesis - reactive oxygen species
    1646 (AKR1C2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     1646 (AKR1C2)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     1646 (AKR1C2)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 1646
NCBI-ProteinID: NP_001345
OMIM: 600450
HGNC: 385
Ensembl: ENSG00000151632
Vega: OTTHUMG00000017584
Pharos: P52895(Tchem)
UniProt: P52895
Structure
PDB: 

Position
10p15.1
AA seq 323 aa
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atggattcgaaataccagtgtgtgaagctgaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcgcctgcagaggttcctaaaagtaaagctctagaggccgtcaaattg
gcaatagaagccgggttccaccatattgattctgcacatgtttacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggagcaattcccatcgaccagagttggtccgaccagccttggaa
aggtcactgaaaaatcttcaattggactatgttgacctctatcttattcattttccagtg
tctgtaaagccaggtgaggaagtgatcccaaaagatgaaaatggaaaaatactatttgac
acagtggatctctgtgccacatgggaggccatggagaagtgtaaagatgcaggattggcc
aagtccatcggggtgtccaacttcaaccacaggctgctggagatgatcctcaacaagcca
gggctcaagtacaagcctgtctgcaaccaggtggaatgtcatccttacttcaaccagaga
aaactgctggatttctgcaagtcaaaagacattgttctggttgcctatagtgctctggga
tcccatcgagaagaaccatgggtggacccgaactccccggtgctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcgcatcagacagaac
gtgcaggtgtttgaattccagttgacttcagaggagatgaaagccatagatggcctaaac
agaaatgtgcgatatttgacccttgatatttttgctggcccccctaattatccattttct
gatgaatattaa

KEGG   Homo sapiens (human): 8644
Entry
8644              CDS       T01001                                 

Symbol
AKR1C3, DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, PGFS, hluPGFS
Name
(RefSeq) aldo-keto reductase family 1 member C3
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00590  Arachidonic acid metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa04913  Ovarian steroidogenesis
hsa05208  Chemical carcinogenesis - reactive oxygen species
Network
nt06226  KEAP1-NRF2 signaling
nt06251  CYP-mediated ROS formation
  Element
N01401  Benzo[a]pyrenre to CYP-mediated metabolism
N01413  Metals to KEAP1-NRF2 signalig pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    8644 (AKR1C3)
   00590 Arachidonic acid metabolism
    8644 (AKR1C3)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    8644 (AKR1C3)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    8644 (AKR1C3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    8644 (AKR1C3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     8644 (AKR1C3)
    1.1.1.188  prostaglandin-F synthase
     8644 (AKR1C3)
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     8644 (AKR1C3)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     8644 (AKR1C3)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 8644
NCBI-ProteinID: NP_001240837
OMIM: 603966
HGNC: 386
Ensembl: ENSG00000196139
Vega: OTTHUMG00000017585
Pharos: P42330(Tchem)
UniProt: P42330 A0A0A0MSS8
Structure
PDB: 

Position
10p15.1
AA seq 323 aa
MDSKHQCLKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atggattcaaaacatcagtgtttgaagctaaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcacctccagaggttccgagaagtaaagctttggaggtcacaaaatta
gcaatagaagctgggttccgccatatagattctgctcatttatacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggtccacttttcatcgaccagagttggtccgaccagccttggaa
aactcactgaagaaagctcaattggactatgttgacctctatcttattcattctccaatg
tctctaaagccaggtgaggaactttcaccaacagatgaaaatggaaaagtaatatttgac
atagtggatctctgtaccacctgggaggccatggagaagtgtaaggatgcaggattggcc
aagtccattggggtgtcaaacttcaaccgcaggcagctggagatgatcctcaacaagcca
ggactcaagtacaagcctgtctgcaaccaggtagaatgtcatccgtatttcaaccggagt
aaattgctagatttctgcaagtcgaaagatattgttctggttgcctatagtgctctggga
tctcaacgagacaaacgatgggtggacccgaactccccggtgctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcgcatcagacagaac
gtgcaggtttttgagttccagttgactgcagaggacatgaaagccatagatggcctagac
agaaatctccactattttaacagtgatagttttgctagccaccctaattatccatattca
gatgaatattaa

DBGET integrated database retrieval system