KEGG   Homo sapiens (human): 133Help
Entry
133               CDS       T01001                                 

Gene name
ADM, AM, PAMP
Definition
(RefSeq) adrenomedullin
  KO
K12333  adrenomedullin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    133 (ADM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calc_CGRP_IAPP Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 133
NCBI-ProteinID: NP_001115
OMIM: 103275
HGNC: 259
Ensembl: ENSG00000148926
Vega: OTTHUMG00000165907
Pharos: P35318(Tbio)
UniProt: P35318
Structure
PDB: 

Position
11p15.4
AA seq 185 aa AA seqDB search
MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVK
AGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKL
AHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGS
APHFL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggtttccgtcgccctgatgtacctgggttcgctcgccttcctaggcgctgac
accgctcggttggatgtcgcgtcggagtttcgaaagaagtggaataagtgggctctgagt
cgtgggaagagggaactgcggatgtccagcagctaccccaccgggctcgctgacgtgaag
gccgggcctgcccagacccttattcggccccaggacatgaagggtgcctctcgaagcccc
gaagacagcagtccggatgccgcccgcatccgagtcaagcgctaccgccagagcatgaac
aacttccagggcctccggagctttggctgccgcttcgggacgtgcacggtgcagaagctg
gcacaccagatctaccagttcacagataaggacaaggacaacgtcgcccccaggagcaag
atcagcccccagggctacggccgccggcgccggcgctccctgcccgaggccggcccgggt
cggactctggtgtcttctaagccacaagcacacggggctccagcccccccgagtggaagt
gctccccactttctttag

DBGET integrated database retrieval system