KEGG   Homo sapiens (human): 23394Help
Entry
23394             CDS       T01001                                 

Gene name
ADNP, ADNP1, HVDAS, MRD28
Definition
(RefSeq) activity dependent neuroprotector homeobox
  KO
K22591  activity-dependent neuroprotector homeobox protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23394 (ADNP)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    23394 (ADNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox zf-C2H2_4 zf-Di19 Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 23394
NCBI-ProteinID: NP_001269460
OMIM: 611386
HGNC: 15766
Ensembl: ENSG00000101126
Vega: OTTHUMG00000032737
Pharos: Q9H2P0(Tbio)
UniProt: Q9H2P0
Position
20q13.13
AA seq 1102 aa AA seqDB search
MFQLPVNNLGSLRKARKTVKKILSDIGLEYCKEHIEDFKQFEPNDFYLKNTTWEDVGLWD
PSLTKNQDYRTKPFCCSACPFSSKFFSAYKSHFRNVHSEDFENRILLNCPYCTFNADKKT
LETHIKIFHAPNASAPSSSLSTFKDKNKNDGLKPKQADSVEQAVYYCKKCTYRDPLYEIV
RKHIYREHFQHVAAPYIAKAGEKSLNGAVPLGSNAREESSIHCKRCLFMPKSYEALVQHV
IEDHERIGYQVTAMIGHTNVVVPRSKPLMLIAPKPQDKKSMGLPPRIGSLASGNVRSLPS
QQMVNRLSIPKPNLNSTGVNMMSSVHLQQNNYGVKSVGQGYSVGQSMRLGLGGNAPVSIP
QQSQSVKQLLPSGNGRSYGLGSEQRSQAPARYSLQSANASSLSSGQLKSPSLSQSQASRV
LGQSSSKPAAAATGPPPGNTSSTQKWKICTICNELFPENVYSVHFEKEHKAEKVPAVANY
IMKIHNFTSKCLYCNRYLPTDTLLNHMLIHGLSCPYCRSTFNDVEKMAAHMRMVHIDEEM
GPKTDSTLSFDLTLQQGSHTNIHLLVTTYNLRDAPAESVAYHAQNNPPVPPKPQPKVQEK
ADIPVKSSPQAAVPYKKDVGKTLCPLCFSILKGPISDALAHHLRERHQVIQTVHPVEKKL
TYKCIHCLGVYTSNMTASTITLHLVHCRGVGKTQNGQDKTNAPSRLNQSPSLAPVKRTYE
QMEFPLLKKRKLDDDSDSPSFFEEKPEEPVVLALDPKGHEDDSYEARKSFLTKYFNKQPY
PTRREIEKLAASLWLWKSDIASHFSNKRKKCVRDCEKYKPGVLLGFNMKELNKVKHEMDF
DAEWLFENHDEKDSRVNASKTADKKLNLGKEDDSSSDSFENLEEESNESGSPFDPVFEVE
PKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQD
DVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQ
GDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNM
TDGVAEPMHGSLAGVKLSSQQA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgttccaacttcctgtcaacaatcttggcagtttaagaaaagcccggaaaactgtgaaa
aaaatacttagtgacattgggttggaatactgtaaagaacatatagaagattttaaacaa
tttgaacctaatgacttttatttgaaaaacactacatgggaggatgtaggactgtgggac
ccatcacttacgaaaaaccaggactatcggacaaaacctttctgctgcagcgcttgtcca
ttttcctcaaaattcttctctgcctacaaaagtcatttccgcaatgtccatagtgaagac
tttgaaaataggattctccttaattgcccctactgtaccttcaatgcagacaaaaagact
ttggaaacacacattaaaatatttcatgctccgaacgccagcgcaccaagtagcagcctc
agcactttcaaagataaaaacaaaaatgatggccttaaacctaagcaggctgacagtgta
gagcaagctgtttattactgtaagaagtgcacttaccgagatcctctttatgaaatagtt
aggaagcacatttacagggaacattttcagcatgtggcagcaccttacatagcaaaggca
ggagaaaaatcactcaatggggcagtccccttaggctcgaatgcccgagaagagagtagt
attcactgcaagcgatgccttttcatgccaaagtcctatgaagctttggtacagcatgtc
atcgaagaccatgaacgtataggctatcaggtcactgccatgattgggcacacaaatgta
gtggttccccgatccaaacccttgatgctaattgctcccaaacctcaagacaagaagagc
atgggactcccaccaaggatcggttcccttgcttctggaaatgtccggtctttaccatca
cagcagatggtgaatcgactctcaataccaaagcctaacttaaattctacaggagtcaac
atgatgtccagtgttcatctgcagcagaacaactatggagtcaaatctgtaggccagggt
tacagtgttggtcagtcaatgagactgggtctaggtggcaacgcaccagtttccattcct
caacaatctcagtctgtaaagcagttacttccaagtggaaacggaaggtcttatgggctt
gggtcagagcagaggtcccaggcaccagcaagatactccctgcagtctgctaatgcctct
tctctctcatcgggccagttaaagtctccttccctctctcagtcacaggcatccagagtg
ttaggtcagtccagttccaaacctgctgcagctgccacaggccctcccccaggtaacact
tcctcaactcaaaagtggaaaatatgtacaatctgtaatgagctttttcctgaaaatgtc
tatagtgtgcacttcgaaaaagaacataaagctgagaaagtcccagcagtagccaactac
attatgaaaatacacaattttactagcaaatgcctctactgtaatcgctatttacccaca
gatactctgctcaaccatatgttaattcatggtctgtcttgtccatattgccgttcaact
ttcaatgatgtggaaaagatggccgcacacatgcggatggttcacattgatgaagagatg
ggacctaaaacagattctactttgagttttgatttgacattgcagcagggtagtcacact
aacatccatctcctggtaactacatacaatctgagggatgccccagctgaatctgttgct
taccatgcccaaaataatcctccagttcctccaaagccacagccaaaggttcaggaaaag
gcagatatccctgtaaaaagttcacctcaagctgcagtgccctataaaaaagatgttggg
aaaaccctttgtcctctttgcttttcaatcctaaaaggacccatatctgatgcacttgca
catcacttacgagagaggcaccaagttattcagacggttcatccagttgagaaaaagctc
acctacaaatgtatccattgccttggtgtgtataccagcaacatgaccgcctcaactatc
actctgcatctagttcactgcaggggcgttggaaagacccaaaatggccaggataagaca
aatgcaccctctcggcttaatcagtctccaagtctggcacctgtgaagcgcacttacgag
caaatggaatttcccttactgaaaaaacgaaagttagatgatgatagtgattcacccagc
ttctttgaagagaagcctgaagagcctgttgttttagctttagaccccaagggtcatgaa
gatgattcctatgaagccaggaaaagctttctaacaaagtatttcaacaaacagccctat
cccaccaggagagaaattgagaagctagcagccagtttatggttatggaagagtgacatc
gcttcccattttagtaacaaaaggaagaagtgtgtccgtgattgtgaaaagtacaagcct
ggcgtgttgctggggtttaacatgaaagaattaaataaagtcaagcatgagatggatttt
gatgctgagtggctatttgaaaatcatgatgagaaggattccagagtcaatgctagtaag
actgctgacaaaaagctcaaccttgggaaggaagatgacagttcctcagacagttttgaa
aatttggaagaagaatccaatgaaagtggtagcccttttgaccctgtttttgaagttgaa
cctaaaatctctaacgataacccagaggaacatgtactgaaggtaattcctgaggatgct
tcagaatctgaggagaagctagaccaaaaagaggatggttcaaaatacgaaactattcat
ttgactgaggaaccaaccaaactaatgcacaatgcatctgatagtgaggttgaccaagac
gatgttgttgagtggaaagacggtgcttctccatctgagagtgggcctggatcccaacaa
gtgtcagactttgaggacaatacctgcgaaatgaaaccaggaacctggtctgacgagtct
tcccaaagcgaagatgcaaggagcagtaagccagctgccaaaaaaaaggctaccatgcaa
ggtgacagagagcagttgaaatggaagaatagttcctatggaaaagttgaagggttttgg
tctaaggaccagtcacagtggaagaatgcatctgagaatgatgagcgcttatctaacccc
cagattgagtggcagaatagcacaattgacagtgaggatggggaacagtttgacaacatg
actgatggagtagctgagcccatgcatggcagcttagccggagttaaactgagcagccaa
caggcctaa

DBGET integrated database retrieval system