KEGG   Homo sapiens (human): 284Help
Entry
284               CDS       T01001                                 

Gene name
ANGPT1, AGP1, AGPT, ANG1
Definition
(RefSeq) angiopoietin 1
  KO
K05465  angiopoietin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05323  Rheumatoid arthritis
Drug target
Trebananib: D10177
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    284 (ANGPT1)
   04015 Rap1 signaling pathway
    284 (ANGPT1)
   04010 MAPK signaling pathway
    284 (ANGPT1)
   04066 HIF-1 signaling pathway
    284 (ANGPT1)
   04151 PI3K-Akt signaling pathway
    284 (ANGPT1)
 09160 Human Diseases
  09162 Immune diseases
   05323 Rheumatoid arthritis
    284 (ANGPT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    284 (ANGPT1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   284 (ANGPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 284
NCBI-ProteinID: NP_001137
OMIM: 601667
HGNC: 484
Ensembl: ENSG00000154188
Vega: OTTHUMG00000164812
Pharos: Q15389(Tbio)
UniProt: Q15389
Structure
PDB: 

Position
8q23.1
AA seq 498 aa AA seqDB search
MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagttttcctttcctttgctttcctcgctgccattctgactcacatagggtgcagc
aatcagcgccgaagtccagaaaacagtgggagaagatataaccggattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgatggcaactgtcgtgagagtacgacagac
cagtacaacacaaacgctctgcagagagatgctccacacgtggaaccggatttctcttcc
cagaaacttcaacatctggaacatgtgatggaaaattatactcagtggctgcaaaaactt
gagaattacattgtggaaaacatgaagtcggagatggcccagatacagcagaatgcagtt
cagaaccacacggctaccatgctggagataggaaccagcctcctctctcagactgcagag
cagaccagaaagctgacagatgttgagacccaggtactaaatcaaacttctcgacttgag
atacagctgctggagaattcattatccacctacaagctagagaagcaacttcttcaacag
acaaatgaaatcttgaagatccatgaaaaaaacagtttattagaacataaaatcttagaa
atggaaggaaaacacaaggaagagttggacaccttaaaggaagagaaagagaaccttcaa
ggcttggttactcgtcaaacatatataatccaggagctggaaaagcaattaaacagagct
accaccaacaacagtgtccttcagaagcagcaactggagctgatggacacagtccacaac
cttgtcaatctttgcactaaagaaggtgttttactaaagggaggaaaaagagaggaagag
aaaccatttagagactgtgcagatgtatatcaagctggttttaataaaagtggaatctac
actatttatattaataatatgccagaacccaaaaaggtgttttgcaatatggatgtcaat
gggggaggttggactgtaatacaacatcgtgaagatggaagtctagatttccaaagaggc
tggaaggaatataaaatgggttttggaaatccctccggtgaatattggctggggaatgag
tttatttttgccattaccagtcagaggcagtacatgctaagaattgagttaatggactgg
gaagggaaccgagcctattcacagtatgacagattccacataggaaatgaaaagcaaaac
tataggttgtatttaaaaggtcacactgggacagcaggaaaacagagcagcctgatctta
cacggtgctgatttcagcactaaagatgctgataatgacaactgtatgtgcaaatgtgcc
ctcatgttaacaggaggatggtggtttgatgcttgtggcccctccaatctaaatggaatg
ttctatactgcgggacaaaaccatggaaaactgaatgggataaagtggcactacttcaaa
gggcccagttactccttacgttccacaactatgatgattcgacctttagatttttga

DBGET integrated database retrieval system