KEGG   Homo sapiens (human): 3381
Entry
3381              CDS       T01001                                 

Gene name
IBSP, BNSP, BSP, BSP-II, SP-II
Definition
(RefSeq) integrin binding sialoprotein
  KO
K06253  integrin binding sialoprotein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3381 (IBSP)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3381 (IBSP)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3381 (IBSP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3381 (IBSP)
SSDB
Motif
Pfam: BSP_II Mpp10 Utp14
Other DBs
NCBI-GeneID: 3381
NCBI-ProteinID: NP_004958
OMIM: 147563
HGNC: 5341
Ensembl: ENSG00000029559
Vega: OTTHUMG00000130600
Pharos: P21815(Tbio)
UniProt: P21815
Position
4q22.1
AA seq 317 aa
MKTALILLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPV
QGSSDSSEENGDDSSEEEEEEEETSNEGENNEESNEDEDSEAENTTLSATTLGYGEDATP
GTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTS
TNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTP
PQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESENGEPRGDNYRAYEDEYSYF
KGQGYDGYDGQNYYHHQ
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaagactgctttaattttgctcagcattttgggaatggcctgtgctttctcaatgaaa
aatttgcatcgaagagtcaaaatagaggattctgaagaaaatggggtctttaagtacagg
ccacgatattatctttacaagcatgcctacttttatcctcatttaaaacgatttccagtt
cagggcagtagtgactcatccgaagaaaatggagatgacagttcagaagaggaggaggaa
gaagaggagacttcaaatgaaggagaaaacaatgaagaatcgaatgaagatgaagactct
gaggctgagaataccacactttctgctacaacactgggctatggagaggacgccacgcct
ggcacagggtatacagggttagctgcaatccagcttcccaagaaggctggggatataaca
aataaagctacaaaagagaaggaaagtgatgaagaagaagaggaggaagaggaaggaaat
gaaaacgaagaaagcgaagcagaagtggatgaaaacgaacaaggcataaacggcaccagt
accaacagcacagaggcagaaaacggcaacggcagcagcggaggagacaatggagaagaa
ggggaagaagaaagtgtcactggagccaatgcagaagacaccacagagaccggaaggcag
ggcaagggcacctcgaagacaacaacctctccaaatggtgggtttgaacctacaacccca
ccacaagtctatagaaccacttccccaccttttgggaaaaccaccaccgttgaatacgag
ggggagtacgaatacacgggcgccaatgaatacgacaatggatatgaaatctatgaaagt
gagaacggggaacctcgtggggacaattaccgagcctatgaagatgagtacagctacttt
aaaggacaaggctacgatggctatgatggtcagaattactaccaccaccagtga

DBGET integrated database retrieval system