KEGG   Homo sapiens (human): 345Help
Entry
345               CDS       T01001                                 

Gene name
APOC3, APOCIII
Definition
(RefSeq) apolipoprotein C3
  KO
K08759  apolipoprotein C-III
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04979  Cholesterol metabolism
Disease
H01199  Hyperalphalipoproteinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    345 (APOC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    345 (APOC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apo-CIII ApoC-I ApoA-II DUF937
Motif
Other DBs
NCBI-GeneID: 345
NCBI-ProteinID: NP_000031
OMIM: 107720
HGNC: 610
Ensembl: ENSG00000110245
Vega: OTTHUMG00000046115
Pharos: P02656(Tbio)
UniProt: P02656 A3KPE2
Structure
PDB: 

Position
11q23.3
AA seq 99 aa AA seqDB search
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccgggtactccttgttgttgccctcctggcgctcctggcctctgcccgagct
tcagaggccgaggatgcctcccttctcagcttcatgcagggttacatgaagcacgccacc
aagaccgccaaggatgcactgagcagcgtgcaggagtcccaggtggcccagcaggccagg
ggctgggtgaccgatggcttcagttccctgaaagactactggagcaccgttaaggacaag
ttctctgagttctgggatttggaccctgaggtcagaccaacttcagccgtggctgcctga

DBGET integrated database retrieval system