KEGG   Homo sapiens (human): 5744
Entry
5744              CDS       T01001                                 

Gene name
PTHLH, BDE2, HHM, PLP, PTHR, PTHRP
Definition
(RefSeq) parathyroid hormone like hormone
  KO
K22608  parathyroid hormone-related hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Disease
H00482  Brachydactyly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5744 (PTHLH)
SSDB
Motif
Pfam: Parathyroid CCDC106
Other DBs
NCBI-GeneID: 5744
NCBI-ProteinID: NP_945316
OMIM: 168470
HGNC: 9607
Ensembl: ENSG00000087494
Vega: OTTHUMG00000169221
Pharos: P12272(Tbio)
UniProt: P12272 A0A024RB29
Structure
PDB: 
3FFD 1BZG

Position
12p11.22
AA seq 177 aa
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFL
HHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLK
TPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
NT seq 534 nt   +upstreamnt  +downstreamnt
atgcagcggagactggttcagcagtggagcgtcgcggtgttcctgctgagctacgcggtg
ccctcctgcgggcgctcggtggagggtctcagccgccgcctcaaaagagctgtgtctgaa
catcagctcctccatgacaaggggaagtccatccaagatttacggcgacgattcttcctt
caccatctgatcgcagaaatccacacagctgaaatcagagctacctcggaggtgtcccct
aactccaagccctctcccaacacaaagaaccaccccgtccgatttgggtctgatgatgag
ggcagatacctaactcaggaaactaacaaggtggagacgtacaaagagcagccgctcaag
acacctgggaagaaaaagaaaggcaagcccgggaaacgcaaggagcaggaaaagaaaaaa
cggcgaactcgctctgcctggttagactctggagtgactgggagtgggctagaaggggac
cacctgtctgacacctccacaacgtcgctggagctcgattcacggaggcattga

DBGET integrated database retrieval system