KEGG   Homo sapiens (human): 60489
Entry
60489             CDS       T01001                                 

Symbol
APOBEC3G, A3G, ARCD, ARP-9, ARP9, CEM-15, CEM15, MDS019, bK150C2.7, dJ494G10.1
Name
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3G
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    60489 (APOBEC3G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    60489 (APOBEC3G)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     60489 (APOBEC3G)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     60489 (APOBEC3G)
SSDB
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N SNAD4 APOBEC3 APOBEC_C APOBEC4 APOBEC4_like APOBEC1 AID Toxin-deaminase Pox_A3L NODP
Other DBs
NCBI-GeneID: 60489
NCBI-ProteinID: NP_068594
OMIM: 607113
HGNC: 17357
Ensembl: ENSG00000239713
Vega: OTTHUMG00000151081
Pharos: Q9HC16(Tbio)
UniProt: Q9HC16
Structure
PDB: 

Position
22q13.1
AA seq 384 aa
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYS
ELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFV
ARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPK
YYILLHIMLGEILRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRG
FLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFIS
KNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQP
WDGLDEHSQDLSGRLRAILQNQEN
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaagcctcacttcagaaacacagtggagcgaatgtatcgagacacattctcctacaac
ttttataatagacccatcctttctcgtcggaataccgtctggctgtgctacgaagtgaaa
acaaagggtccctcaaggccccctttggacgcaaagatctttcgaggccaggtgtattcc
gaacttaagtaccacccagagatgagattcttccactggttcagcaagtggaggaagctg
catcgtgaccaggagtatgaggtcacctggtacatatcctggagcccctgcacaaagtgt
acaagggatatggccacgttcctggccgaggacccgaaggttaccctgaccatctttgtt
gcccgcctctactacttctgggacccagattaccaggaggcgcttcgcagcctgtgtcag
aaaagagacggtccgcgtgccaccatgaagatcatgaattatgacgaatttcagcactgt
tggagcaagttcgtgtacagccaaagagagctatttgagccttggaataatctgcctaaa
tattatatattactgcacatcatgctgggggagattctcagacactcgatggatccaccc
acattcactttcaactttaacaatgaaccttgggtcagaggacggcatgagacttacctg
tgttatgaggtggagcgcatgcacaatgacacctgggtcctgctgaaccagcgcaggggc
tttctatgcaaccaggctccacataaacacggtttccttgaaggccgccatgcagagctg
tgcttcctggacgtgattcccttttggaagctggacctggaccaggactacagggttacc
tgcttcacctcctggagcccctgcttcagctgtgcccaggaaatggctaaattcatttca
aaaaacaaacacgtgagcctgtgcatcttcactgcccgcatctatgatgatcaaggaaga
tgtcaggaggggctgcgcaccctggccgaggctggggccaaaatttcaataatgacatac
agtgaatttaagcactgctgggacacctttgtggaccaccagggatgtcccttccagccc
tgggatggactagatgagcacagccaagacctgagtgggaggctgcgggccattctccag
aatcaggaaaactga

DBGET integrated database retrieval system