KEGG   Homo sapiens (human): 6358
Entry
6358              CDS       T01001                                 

Gene name
CCL14, CC-1, CC-3, CKB1, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14
Definition
(RefSeq) C-C motif chemokine ligand 14
  KO
K21092  C-C motif chemokine 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6358 (CCL14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6358 (CCL14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6358 (CCL14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6358 (CCL14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6358 (CCL14)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6358
NCBI-ProteinID: NP_116739
OMIM: 601392
HGNC: 10612
Ensembl: ENSG00000276409
Vega: OTTHUMG00000188403
Pharos: Q16627(Tbio)
UniProt: Q16627
Structure
PDB: 
2Q8R 2Q8T

Position
17q12
AA seq 93 aa
MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCS
KPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagatctccgtggctgccattcccttcttcctcctcatcaccatcgccctagggacc
aagactgaatcctcctcacggggaccttaccacccctcagagtgctgcttcacctacact
acctacaagatcccgcgtcagcggattatggattactatgagaccaacagccagtgctcc
aagcccggaattgtcttcatcaccaaaaggggccattccgtctgtaccaaccccagtgac
aagtgggtccaggactatatcaaggacatgaaggagaactga

DBGET integrated database retrieval system