KEGG   Homo sapiens (human): 6715
Entry
6715              CDS       T01001                                 

Symbol
SRD5A1, S5AR_1
Name
(RefSeq) steroid 5 alpha-reductase 1
  KO
K12343  3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
Drug target
Alfatradiol: D07121
Bexlosteride: D03107
Dutasteride: D03820<JP/US>
Epristeride: D01134
Idronoxil: D04498
Izonsteride: D04646
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    6715 (SRD5A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     6715 (SRD5A1)
SSDB
Motif
Pfam: Steroid_dh DUF1295 PEMT
Other DBs
NCBI-GeneID: 6715
NCBI-ProteinID: NP_001038
OMIM: 184753
HGNC: 11284
Ensembl: ENSG00000145545
Vega: OTTHUMG00000090456
Pharos: P18405(Tclin)
UniProt: P18405
Position
5p15.31
AA seq 259 aa
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcaacggcgacgggggtggcggaggagcgcctgctggccgcgctcgcctacctgcag
tgcgccgtgggctgcgcggtcttcgcgcgcaatcgtcagacgaactcagtgtacggccgc
cacgcgctgcccagccacaggctccgagtgccggcgcgggccgcctgggtggtgcaggag
ctgccctcgctggccctgccgctctaccagtacgccagcgagtccgccccgcgtctccgc
agcgcgcccaactgcatcctcctggccatgttcctcgtccactacgggcatcggtgctta
atttacccatttctgatgcgaggaggaaagcctatgccactgttggcgtgtacaatggcg
attatgttctgtacctgtaacggctatttgcaaagcagatacttgagccattgtgcagtg
tatgctgatgactgggtaacagatccccgttttctaataggttttggcttgtggttaacg
ggcatgttgataaacatccattcagatcatatcctaaggaatctcagaaaaccaggagat
actggatacaaaataccaaggggaggcttatttgaatacgtaactgcagccaactatttt
ggagaaatcatggagtggtgtggctatgccctggccagctggtctgtccaaggcgcggct
tttgctttcttcacgttttgttttttatctggtagagcaaaagagcatcatgagtggtac
ctccggaaatttgaagagtatccaaagttcagaaaaattataattccatttttgttttaa

KEGG   Homo sapiens (human): 6716
Entry
6716              CDS       T01001                                 

Symbol
SRD5A2
Name
(RefSeq) steroid 5 alpha-reductase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa05215  Prostate cancer
Disease
H00608  46,XY disorder of sex development due to testosterone secretion defect
Drug target
Alfatradiol: D07121
Dutasteride: D03820<JP/US>
Epristeride: D01134
Estramustine (DG00724): D02398 D04066 D06397<JP/US>
Finasteride: D00321<JP/US>
Idronoxil: D04498
Izonsteride: D04646
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    6716 (SRD5A2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    6716 (SRD5A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     6716 (SRD5A2)
SSDB
Motif
Pfam: Steroid_dh DUF1295 PEMT
Other DBs
NCBI-GeneID: 6716
NCBI-ProteinID: NP_000339
OMIM: 607306
HGNC: 11285
Ensembl: ENSG00000277893
Vega: OTTHUMG00000152057
Pharos: P31213(Tclin)
UniProt: P31213
Position
2p23.1
AA seq 254 aa
MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcaggttcagtgccagcagagcccagtgctggcaggcagcgccactttggtcgccctt
ggggcactggccttgtacgtcgcgaagccctccggctacgggaagcacacggagagcctg
aagccggcggctacccgcctgccagcccgcgccgcctggttcctgcaggagctgccttcc
ttcgcggtgcccgcggggatcctcgcccggcagcccctctccctcttcgggccacctggg
acggtacttctgggcctcttctgcctacattacttccacaggacatttgtgtactcactg
ctcaatcgagggaggccttatccagctatactcattctcagaggcactgccttctgcact
ggaaatggagtccttcaaggctactatctgatttactgtgctgaataccctgatgggtgg
tacacagacatacggtttagcttgggtgtcttcttatttattttgggaatgggaataaac
attcatagtgactatatattgcgccagctcaggaagcctggagaaatcagctacaggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttcctcggtgagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcacttgcatttgcatttttctca
ctttgtttccttgggctgcgagcttttcaccaccataggttctacctcaagatgtttgag
gactaccccaaatctcggaaagcccttattccattcatcttttaa

KEGG   Homo sapiens (human): 79644
Entry
79644             CDS       T01001                                 

Symbol
SRD5A3, CDG1P, CDG1Q, KRIZI, SRD5A2L, SRD5A2L1
Name
(RefSeq) steroid 5 alpha-reductase 3
  KO
K12345  3-oxo-5-alpha-steroid 4-dehydrogenase 3 / polyprenol reductase [EC:1.3.1.22 1.3.1.94]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
Network
nt06015  N-Glycan biosynthesis
  Element
N00675  N-Glycan precursor biosynthesis, farnesy-PP to P-Dol
N00676  DOLK deficiency in N-glycan precursor biosynthesis
N00677  SRD5A3 deficiency in N-glycan precursor biosynthesis
Disease
H00118  Congenital disorders of glycosylation type I
Drug target
Idronoxil: D04498
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    79644 (SRD5A3)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    79644 (SRD5A3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     79644 (SRD5A3)
    1.3.1.94  polyprenol reductase
     79644 (SRD5A3)
SSDB
Motif
Pfam: Steroid_dh
Other DBs
NCBI-GeneID: 79644
NCBI-ProteinID: NP_078868
OMIM: 611715
HGNC: 25812
Ensembl: ENSG00000128039
Vega: OTTHUMG00000128733
Pharos: Q9H8P0(Tbio)
UniProt: Q9H8P0
Position
4q12
AA seq 318 aa
MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEP
SRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQF
QGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQ
VPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNH
RIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYK
SKFVSYPKHRKAFLPFLF
NT seq 957 nt   +upstreamnt  +downstreamnt
atggctccctgggcggaggccgagcactcggcgctgaacccgctgcgcgcggtgtggctc
acgctgaccgccgccttcctgctgaccctactgctgcagctcctgccgcccggcctgctc
ccgggctgcgcgatcttccaggacctgatccgctatgggaaaaccaagtgtggggagccg
tcgcgccccgccgcctgccgagcctttgatgtccccaagagatatttttcccacttttat
atcatctcagtgctgtggaatggcttcctgctttggtgccttactcaatctctgttcctg
ggagcaccttttccaagctggcttcatggtttgctcagaattctcggggcggcacagttc
cagggaggggagctggcactgtctgcattcttagtgctagtatttctgtggctgcacagc
ttacgaagactcttcgagtgcctctacgtcagtgtcttctccaatgtcatgattcacgtc
gtgcagtactgttttggacttgtctattatgtccttgttggcctaactgtgctgagccaa
gtgccaatggatggcaggaatgcctacataacagggaaaaatctattgatgcaagcacgg
tggttccatattcttgggatgatgatgttcatctggtcatctgcccatcagtataagtgc
catgttattctcggcaatctcaggaaaaataaagcaggagtggtcattcactgtaaccac
aggatcccatttggagactggtttgaatatgtttcttcccctaactacttagcagagctg
atgatctacgtttccatggccgtcacctttgggttccacaacttaacttggtggctagtg
gtgacaaatgtcttctttaatcaggccctgtctgcctttctcagccaccaattctacaaa
agcaaatttgtctcttacccgaagcataggaaagctttcctaccatttttgttttaa

DBGET integrated database retrieval system