KEGG   Homo sapiens (human): 79924
Entry
79924             CDS       T01001                                 

Gene name
ADM2, AM2, dJ579N16.4
Definition
(RefSeq) adrenomedullin 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 79924
NCBI-ProteinID: NP_001240774
OMIM: 608682
HGNC: 28898
Ensembl: ENSG00000128165
Vega: OTTHUMG00000150202
Pharos: Q7Z4H4(Tbio)
CPD: C16128
UniProt: Q7Z4H4
Position
22q13.33
AA seq 148 aa
MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVW
KLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNL
SHRLWQLMGPAGRQDSAPVDPSSPHSYG
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcccggatcccgacggccgccctgggttgcatcagcctcctctgcctgcagctccct
ggctcgctgtcccgcagcctgggcggggacccgcgacccgtcaaacccagggagccccca
gcccggagcccttccagcagcctgcagcccaggcaccccgcaccccgacctgtggtctgg
aagcttcaccgggccctccaggcacagaggggtgccggcctggcccctgttatgggtcag
cctctccgggatggtggccgccaacactcgggcccccgaagacactcgggcccccgcagg
acccaagcccagctcctgcgagtgggctgtgtgctgggcacctgccaggtgcagaatctc
agccaccgcctgtggcaactcatgggaccggccggccggcaggactcagctcctgtggac
cccagcagcccccacagctatggctga

DBGET integrated database retrieval system