KEGG   Homo sapiens (human): 8862Help
Entry
8862              CDS       T01001                                 

Gene name
APLN, APEL, XNPEP2
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    8862 (APLN)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8862 (APLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apelin
Motif
Other DBs
NCBI-GeneID: 8862
NCBI-ProteinID: NP_059109
OMIM: 300297
HGNC: 16665
Ensembl: ENSG00000171388
Vega: OTTHUMG00000022371
Pharos: Q9ULZ1(Tchem)
UniProt: Q9ULZ1
Position
Xq26.1
AA seq 77 aa AA seqDB search
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgaccgcggtg
tgtggagggtccctgatgccgcttcccgatgggaatgggctggaagacggcaatgtccgc
cacctggtgcagcccagagggtcaaggaatgggccagggccctggcagggaggtcggagg
aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system