KEGG   Homo sapiens (human): 9048Help
Entry
9048              CDS       T01001                                 

Gene name
ARTN, ART, ENOVIN, EVN, NBN
Definition
(RefSeq) artemin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta
Motif
Other DBs
NCBI-GeneID: 9048
NCBI-ProteinID: NP_476432
OMIM: 603886
HGNC: 727
Ensembl: ENSG00000117407
Vega: OTTHUMG00000007705
Pharos: Q5T4W7(Tbio)
UniProt: Q5T4W7
Structure
PDB: 

Position
1p34.1
AA seq 220 aa AA seqDB search
MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLAS
PAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGA
RGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGS
RPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaacttggacttggaggcctctccacgctgtcccactgcccctggcctaggcagcag
cctgccctgtggcccaccctggccgctctggctctgctgagcagcgtcgcagaggcctcc
ctgggctccgcgccccgcagccctgccccccgcgaaggccccccgcctgtcctggcgtcc
cccgccggccacctgccggggggacgcacggcccgctggtgcagtggaagagcccggcgg
ccgccgccgcagccttctcggcccgcgcccccgccgcctgcacccccatctgctcttccc
cgcgggggccgcgcggcgcgggctgggggcccgggcagccgcgctcgggcagcgggggcg
cggggctgccgcctgcgctcgcagctggtgccggtgcgcgcgctcggcctgggccaccgc
tccgacgagctggtgcgtttccgcttctgcagcggctcctgccgccgcgcgcgctctcca
cacgacctcagcctggccagcctactgggcgccggggccctgcgaccgcccccgggctcc
cggcccgtcagccagccctgctgccgacccacgcgctacgaagcggtctccttcatggac
gtcaacagcacctggagaaccgtggaccgcctctccgccaccgcctgcggctgcctgggc
tga

DBGET integrated database retrieval system