KEGG   Homo sapiens (human): 9210
Entry
9210              CDS       T01001                                 

Gene name
BMP15, GDF9B, ODG2, POF4
Definition
(RefSeq) bone morphogenetic protein 15
  KO
K05498  bone morphogenetic protein 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04913  Ovarian steroidogenesis
Disease
H00599  46,XX gonadal dysgenesis
H00627  Premature ovarian failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9210 (BMP15)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    9210 (BMP15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9210 (BMP15)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   9210 (BMP15)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 9210
NCBI-ProteinID: NP_005439
OMIM: 300247
HGNC: 1068
Ensembl: ENSG00000130385
Vega: OTTHUMG00000021525
Pharos: O95972(Tbio)
UniProt: O95972
Position
Xp11.22
AA seq 392 aa
MVLLSILRILFLCELVLFMEHRAQMAEGGQSSIALLAEAPTLPLIEELLEESPGEQPRKP
RLLGHSLRYMLELYRRSADSHGHPRENRTIGATMVRLVKPLTNVARPHRGTWHIQILGFP
LRPNRGLYQLVRATVVYRHHLQLTRFNLSCHVEPWVQKNPTNHFPSSEGDSSKPSLMSNA
WKEMDITQLVQQRFWNNKGHRILRLRFMCQQQKDSGGLELWHGTSSLDIAFLLLYFNDTH
KSIRKAKFLPRGMEEFMERESLLRRTRQADGISAEVTASSSKHSGPENNQCSLHPFQISF
RQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPY
KYVPISVLMIEANGSILYKEYEGMIAESCTCR
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggtcctcctcagtattcttagaattctttttctttgtgaactcgtgcttttcatggaa
cacagggcccaaatggcagaaggagggcagtcctctattgcccttctggctgaggcccct
actttgcccctgattgaggagctgctagaagaatcccctggcgaacagccaaggaagccc
cggctcctagggcattcactgcggtacatgctggagttgtaccggcgttcagctgactcg
catgggcaccctagagagaaccgcaccattggggccaccatggtgaggctggtgaagccc
ttgaccaatgtggcaaggcctcacagaggtacctggcatatacagatcctgggctttcct
ctcagaccaaaccgaggactataccaactagttagagccactgtggtttaccgccatcat
ctccaactaactcgcttcaatctctcctgccatgtggagccctgggtgcagaaaaaccca
accaaccacttcccttcctcagaaggagattcctcaaaaccttccctgatgtctaacgct
tggaaagagatggatatcacacaacttgttcagcaaaggttctggaataacaagggacac
aggatcctacgactccgttttatgtgtcagcagcaaaaagatagtggtggtcttgagctc
tggcatggcacttcatccttggacattgccttcttgttactctatttcaatgatactcat
aaaagcattcggaaggctaaatttcttcccaggggcatggaggagttcatggaaagggaa
tctcttctccggagaacccgacaagcagatggtatctcagctgaggttactgcctcttcc
tcaaaacatagcgggcctgaaaataaccagtgttccctccaccctttccaaatcagcttc
cgccagctgggttgggatcactggatcattgctccccctttctacaccccaaactactgt
aaaggaacttgtctccgagtactacgcgatggtctcaattcccccaatcacgccattatt
cagaaccttatcaatcagttggtggaccagagtgtcccccggccctcctgtgtcccgtat
aagtatgttccaattagtgtccttatgattgaggcaaatgggagtattttgtacaaggag
tatgagggtatgattgctgagtcttgtacatgcagatga

DBGET integrated database retrieval system