KEGG   Homo sapiens (human): 10142Help
Entry
10142             CDS       T01001                                 

Gene name
AKAP9, AKAP-9, AKAP350, AKAP450, CG-NAP, HYPERION, LQT11, MU-RMS-40.16A, PPP1R45, PRKA9, YOTIAO
Definition
(RefSeq) A-kinase anchoring protein 9
  KO
K16551  A-kinase anchor protein 9
Organism
hsa  Homo sapiens (human)
Disease
H00720  Long QT syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10142 (AKAP9)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10142 (AKAP9)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10142 (AKAP9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Kinase anchoring protein
     10142 (AKAP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PACT_coil_coil
Motif
Other DBs
NCBI-GeneID: 10142
NCBI-ProteinID: NP_005742
OMIM: 604001
HGNC: 379
Ensembl: ENSG00000127914
Vega: OTTHUMG00000131127
Pharos: Q99996(Tbio)
UniProt: Q99996 Q6PJH3 Q5GIA7
Position
7q21.2
AA seq 3907 aa AA seqDB search
MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVSAHHDLNIDQS
QCNEMYINSSQRVESTVIPESTIMRTLHSGEITSHEQGFSVELESEISTTADDCSSEVNG
CSFVMRTGKPTNLLREEEFGVDDSYSEQGAQDSPTHLEMMESELAGKQHEIEELNRELEE
MRVTYGTEGLQQLQEFEAAIKQRDGIITQLTANLQQARREKDETMREFLELTEQSQKLQI
QFQQLQASETLRNSTHSSTAADLLQAKQQILTHQQQLEEQDHLLEDYQKKKEDFTMQISF
LQEKIKVYEMEQDKKVENSNKEEIQEKETIIEELNTKIIEEEKKTLELKDKLTTADKLLG
ELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQ
RMEQETQRKLEQLRAELDEMYGQQIVQMKQELIRQHMAQMEEMKTRHKGEMENALRSYSN
ITVNEDQIKLMNVAINELNIKLQDTNSQKEKLKEELGLILEEKCALQRQLEDLVEELSFS
REQIQRARQTIAEQESKLNEAHKSLSTVEDLKAEIVSASESRKELELKHEAEVTNYKIKL
EMLEKEKNAVLDRMAESQEAELERLRTQLLFSHEEELSKLKEDLEIEHRINIEKLKDNLG
IHYKQQIDGLQNEMSQKIETMQFEKDNLITKQNQLILEISKLKDLQQSLVNSKSEEMTLQ
INELQKEIEILRQEEKEKGTLEQEVQELQLKTELLEKQMKEKENDLQEKFAQLEAENSIL
KDEKKTLEDMLKIHTPVSQEERLIFLDSIKSKSKDSVWEKEIEILIEENEDLKQQCIQLN
EEIEKQRNTFSFAEKNFEVNYQELQEEYACLLKVKDDLEDSKNKQELEYKSKLKALNEEL
HLQRINPTTVKMKSSVFDEDKTFVAETLEMGEVVEKDTTELMEKLEVTKREKLELSQRLS
DLSEQLKQKHGEISFLNEEVKSLKQEKEQVSLRCRELEIIINHNRAENVQSCDTQVSSLL
DGVVTMTSRGAEGSVSKVNKSFGEESKIMVEDKVSFENMTVGEESKQEQLILDHLPSVTK
ESSLRATQPSENDKLQKELNVLKSEQNDLRLQMEAQRICLSLVYSTHVDQVREYMENEKD
KALCSLKEELIFAQEEKIKELQKIHQLELQTMKTQETGDEGKPLHLLIGKLQKAVSEECS
YFLQTLCSVLGEYYTPALKCEVNAEDKENSGDYISENEDPELQDYRYEVQDFQENMHTLL
NKVTEEYNKLLVLQTRLSKIWGQQTDGMKLEFGEENLPKEETEFLSIHSQMTNLEDIDVN
HKSKLSSLQDLEKTKLEEQVQELESLISSLQQQLKETEQNYEAEIHCLQKRLQAVSESTV
PPSLPVDSVVITESDAQRTMYPGSCVKKNIDGTIEFSGEFGVKEETNIVKLLEKQYQEQL
EEEVAKVIVSMSIAFAQQTELSRISGGKENTASSKQAHAVCQQEQHYFNEMKLSQDQIGF
QTFETVDVKFKEEFKPLSKELGEHGKEILLSNSDPHDIPESKDCVLTISEEMFSKDKTFI
VRQSIHDEISVSSMDASRQLMLNEEQLEDMRQELVRQYQEHQQATELLRQAHMRQMERQR
EDQEQLQEEIKRLNRQLAQRSSIDNENLVSERERVLLEELEALKQLSLAGREKLCCELRN
SSTQTQNGNENQGEVEEQTFKEKELDRKPEDVPPEILSNERYALQKANNRLLKILLEVVK
TTAAVEETIGRHVLGILDRSSKSQSSASLIWRSEAEASVKSCVHEEHTRVTDESIPSYSG
SDMPRNDINMWSKVTEEGTELSQRLVRSGFAGTEIDPENEELMLNISSRLQAAVEKLLEA
ISETSSQLEHAKVTQTELMRESFRQKQEATESLKCQEELRERLHEESRAREQLAVELSKA
EGVIDGYADEKTLFERQIQEKTDIIDRLEQELLCASNRLQELEAEQQQIQEERELLSRQK
EAMKAEAGPVEQQLLQETEKLMKEKLEVQCQAEKVRDDLQKQVKALEIDVEEQVSRFIEL
EQEKNTELMDLRQQNQALEKQLEKMRKFLDEQAIDREHERDVFQQEIQKLEQQLKVVPRF
QPISEHQTREVEQLANHLKEKTDKCSELLLSKEQLQRDIQERNEEIEKLEFRVRELEQAL
LVSADTFQKVEDRKHFGAVEAKPELSLEVQLQAERDAIDRKEKEITNLEEQLEQFREELE
NKNEEVQQLHMQLEIQKKESTTRLQELEQENKLFKDDMEKLGLAIKESDAMSTQDQHVLF
GKFAQIIQEKEVEIDQLNEQVTKLQQQLKITTDNKVIEEKNELIRDLETQIECLMSDQEC
VKRNREEEIEQLNEVIEKLQQELANIGQKTSMNAHSLSEEADSLKHQLDVVIAEKLALEQ
QVETANEEMTFMKNVLKETNFKMNQLTQELFSLKRERESVEKIQSIPENSVNVAIDHLSK
DKPELEVVLTEDALKSLENQTYFKSFEENGKGSIINLETRLLQLESTVSAKDLELTQCYK
QIKDMQEQGQFETEMLQKKIVNLQKIVEEKVAAALVSQIQLEAVQEYAKFCQDNQTISSE
PERTNIQNLNQLREDELGSDISALTLRISELESQVVEMHTSLILEKEQVEIAEKNVLEKE
KKLLELQKLLEGNEKKQREKEKKRSPQDVEVLKTTTELFHSNEESGFFNELEALRAESVA
TKAELASYKEKAEKLQEELLVKETNMTSLQKDLSQVRDHLAEAKEKLSILEKEDETEVQE
SKKACMFEPLPIKLSKSIASQTDGTLKISSSNQTPQILVKNAGIQINLQSECSSEEVTEI
ISQFTEKIEKMQELHAAEILDMESRHISETETLKREHYVAVQLLKEECGTLKAVIQCLRS
KEGSSIPELAHSDAYQTREICSSDSGSDWGQGIYLTHSQGFDIASEGRGEESESATDSFP
KKIKGLLRAVHNEGMQVLSLTESPYSDGEDHSIQQVSEPWLEERKAYINTISSLKDLITK
MQLQREAEVYDSSQSHESFSDWRGELLLALQQVFLEERSVLLAAFRTELTALGTTDAVGL
LNCLEQRIQEQGVEYQAAMECLQKADRRSLLSEIQALHAQMNGRKITLKREQESEKPSQE
LLEYNIQQKQSQMLEMQVELSSMKDRATELQEQLSSEKMVVAELKSELAQTKLELETTLK
AQHKHLKELEAFRLEVKDKTDEVHLLNDTLASEQKKSRELQWALEKEKAKLGRSEERDKE
ELEDLKFSLESQKQRNLQLNLLLEQQKQLLNESQQKIESQRMLYDAQLSEEQGRNLELQV
LLESEKVRIREMSSTLDRERELHAQLQSSDGTGQSRPPLPSEDLLKELQKQLEEKHSRIV
ELLNETEKYKLDSLQTRQQMEKDRQVHRKTLQTEQEANTEGQKKMHELQSKVEDLQRQLE
EKRQQVYKLDLEGQRLQGIMQEFQKQELEREEKRESRRILYQNLNEPTTWSLTSDRTRNW
VLQQKIEGETKESNYAKLIEMNGGGTGCNHELEMIRQKLQCVASKLQVLPQKASERLQFE
TADDEDFIWVQENIDEIILQLQKLTGQQGEEPSLVSPSTSCGSLTERLLRQNAELTGHIS
QLTEEKNDLRNMVMKLEEQIRWYRQTGAGRDNSSRFSLNGGANIEAIIASEKEVWNREKL
TLQKSLKRAEAEVYKLKAELRNDSLLQTLSPDSEHVTLKRIYGKYLRAESFRKALIYQKK
YLLLLLGGFQECEDATLALLARMGGQPAFTDLEVITNRPKGFTRFRSAVRVSIAISRMKF
LVRRWHRVTGSVSININRDGFGLNQGAEKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYI
RSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQ
FHAGMRR
NT seq 11724 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgaggagagacagaagaagctggaggccggcaaagccaagcttgcccagttt
cgacaaagaaaagctcagtcggatgggcagagtccttccaagaagcagaaaaaaaagaga
aaaacgtcaagcagtaaacatgatgtgtcagcacaccatgatttgaatattgatcaatca
cagtgtaatgaaatgtacataaatagttctcagagagtagaatcaactgtgattcctgaa
tctacaataatgagaactctacatagtggagaaataaccagtcatgagcagggcttctct
gtggaactggaaagtgaaatttcaaccacagcagatgactgcagttcagaggtaaatggt
tgcagttttgtgatgagaacaggaaagcctacaaatttattaagggaagaagaatttggt
gttgatgattcttattctgaacaaggagcacaagacagtccgactcatctagagatgatg
gaaagtgagttggctgggaagcagcatgagattgaagagctaaacagagagctggaagaa
atgagggttacctatgggactgaaggactgcagcagttacaagaatttgaagctgccatt
aaacaaagagatggcattataacccagctcactgctaatttacaacaagcaagaagagaa
aaggatgagacaatgagagaatttttagagttgacagaacagagtcaaaaattacagatt
caatttcagcaattacaggctagtgaaactctgagaaacagcactcatagtagcacagct
gcagacttactacaagccaaacaacagatcctcactcatcaacagcagcttgaagaacaa
gaccacttattagaagattatcagaaaaagaaagaagacttcacaatgcaaattagtttc
ttgcaagagaaaattaaagtatatgaaatggaacaagataaaaaagtagaaaactcaaat
aaagaagaaatacaggaaaaggagacaatcattgaagaattaaacacaaaaataatagaa
gaagaaaagaaaactcttgagctaaaggataaattaacaactgctgataaattactagga
gaattacaagaacagattgtgcaaaagaaccaagaaataaaaaacatgaaattagagctg
actaattctaagcaaaaagaaagacagtcttctgaagaaataaaacagttaatggggaca
gtcgaagaacttcagaagagaaatcataaagacagccagttcgaaactgatatagtacaa
cgaatggaacaagaaacacaaagaaagttagaacaactccgggcagagctggatgagatg
tatgggcagcagatagtgcaaatgaaacaagaattaataagacaacacatggcacagatg
gaggaaatgaaaacacggcataagggagaaatggagaatgctttaaggtcatattcaaat
attacagttaatgaagatcagataaagttaatgaatgtggcaataaatgaactgaatata
aaattgcaagatactaactctcaaaaggaaaaactcaaggaagaactaggactaatttta
gaagaaaagtgtgctctacagagacagcttgaagaccttgttgaagaattgagcttttca
agggaacagattcagagagctagacagacaatagctgaacaagaaagtaaacttaatgaa
gcacataagtcccttagtacagtggaagatttgaaagctgagattgtttctgcatctgaa
tccagaaaggaactagaattaaaacatgaagcagaagttacaaattacaagataaaactt
gaaatgttagaaaaagaaaagaatgctgtgttagacagaatggctgaatcacaagaagct
gaattagagaggctgagaacacagcttctatttagtcacgaagaagagctttccaaactg
aaggaagatttagaaattgaacatcgaataaatattgaaaaacttaaagataatttaggc
attcactataaacagcagatagatggtttacagaatgaaatgagtcaaaagatagaaacc
atgcagtttgaaaaggacaatttgataactaagcagaatcaattaattttggaaatttca
aagctaaaagatttacagcagtctcttgtaaattcaaagtcagaagaaatgactcttcaa
atcaatgaacttcaaaaagaaattgaaatactcagacaagaagaaaaagaaaagggtaca
cttgaacaagaagttcaagaattacaacttaaaacagaattgttagaaaaacagatgaag
gaaaaagagaatgatcttcaagaaaaatttgcacaacttgaagcagagaatagcattctt
aaagatgaaaagaaaacccttgaagacatgttgaaaatacatactcctgttagccaagaa
gaaagattgattttcttagactccattaagtccaaatccaaagactctgtgtgggaaaaa
gaaatagaaatacttatagaggaaaatgaggacctcaaacaacaatgtattcagctaaat
gaagagattgaaaagcaaaggaacactttttcatttgctgaaaaaaactttgaagttaac
tatcaagagttacaagaggagtatgcttgccttctcaaagtaaaagatgatttagaagac
agtaaaaataaacaggaattagagtataaaagtaaacttaaagcacttaatgaagagctt
catttgcaaagaataaatccaactacagtgaaaatgaaaagttctgtctttgatgaagac
aaaacttttgtagcagaaacattggaaatgggtgaggttgttgaaaaggatacaacagaa
ctcatggaaaaacttgaggtaaccaagcgagagaaattagagctgtcacagagactgtct
gatctttctgaacaattgaaacagaaacatggtgagattagttttctaaatgaagaagtt
aaatctttaaagcaagagaaagaacaagtttcattgagatgtagagagctagaaatcatt
attaaccacaacagggcagaaaatgtacagtcatgtgatactcaagtaagctctttatta
gatggagttgtgaccatgacaagcaggggtgctgaaggatcagtttctaaagtaaataaa
agttttggtgaagaatcaaaaataatggtggaagataaagtttcttttgaaaatatgact
gttggagaagaaagtaagcaagaacagttgattttggatcacttaccatctgtaacaaag
gaatcatcacttagagcaactcaaccaagtgaaaatgataaacttcagaaagaactcaat
gtacttaaatcagaacagaatgatttaaggctacagatggaagcccaacgcatttgcctc
tctctggtttattcaactcatgtggatcaggttcgtgaatatatggaaaatgaaaaagat
aaagctctttgcagtcttaaagaagagcttatttttgctcaagaggaaaagatcaaggaa
cttcagaaaatacaccagttagaactacagactatgaaaacacaagaaacaggtgatgaa
ggaaagcctttacatctgctcattggaaaacttcaaaaggcagtgtctgaagaatgttct
tattttttacagactttatgcagtgtccttggtgaatattatactcctgctttaaaatgt
gaagtaaatgcagaagacaaagagaattctggtgattacatttctgaaaatgaagatcca
gaattacaagattatagatatgaagttcaagactttcaagaaaatatgcacactcttctc
aacaaagtaacagaagaatacaacaaactcttggtacttcaaacacgactaagcaagatc
tggggacagcagacagatggtatgaaacttgaatttggagaagaaaaccttccaaaagag
gaaacagagtttttatcaatccattctcagatgaccaatttggaagacattgatgtcaat
cataaaagcaagttatcttctctgcaagatcttgaaaaaactaaacttgaagaacaagtt
caagaattagaaagcctcatatcctctttgcagcaacagttgaaagaaactgaacaaaac
tatgaggcagagatccactgtttacagaagaggcttcaagctgttagtgagtccacggtt
ccgccaagcttacctgttgattcggtggtaattacagaatctgatgcacagagaacaatg
taccctggaagttgtgtgaaaaagaatattgatggtacaatagagttttctggtgaattt
ggagtgaaagaggaaacaaatatcgttaagttgcttgaaaaacaataccaagaacaatta
gaagaagaagtagctaaggttattgtgtcaatgagtatagcatttgctcaacaaactgaa
ctgtctagaatatctgggggaaaagaaaatactgcatcatcaaagcaagcacatgctgtg
tgtcagcaagaacaacattattttaatgaaatgaaattatcacaggatcaaattggtttt
cagacttttgagacagtggatgtgaaatttaaagaagaatttaaaccacttagtaaagag
ttaggagaacatggaaaggaaattttattatcaaatagtgatccccatgatataccagaa
tcaaaggactgtgtgctgactatttcagaagaaatgttctccaaagataaaacatttata
gttagacagtctattcatgatgagatttcagtgtcaagcatggatgcttctagacaacta
atgttgaatgaagaacagttggaagatatgagacaggaacttgtacgacaataccaagaa
catcaacaggcaacggaattgttaaggcaagcacatatgcggcaaatggagagacagcga
gaagaccaggaacagctacaagaagagattaagagacttaatagacaattagcccagaga
tcctccatagataatgaaaacctggtttcagagagagagagggtgcttttagaggagctg
gaagcactaaagcagctgtctttagctggaagagagaagctgtgttgtgagctgcgcaac
agcagtacgcaaacacagaatggaaatgaaaaccaaggagaagttgaagaacaaacattt
aaagaaaaggaattagacagaaaacctgaagatgtgcctcctgagattttgtctaatgaa
aggtatgcactccagaaagctaataatagacttttgaagatcctcttagaagttgtaaag
acaacagcagctgttgaagaaacaattggtcgccatgtccttgggattctagatagatct
agtaaaagccagtcatctgccagcctaatttggaggtcagaagcagaggcatctgtaaag
tcatgtgtccatgaggaacatacaagagttacagatgaatccattccctcttattctgga
agtgatatgccaagaaatgacattaacatgtggtcaaaagtaactgaggaaggaacagag
ctgtcacaacgacttgtgaggagtggttttgctggaactgaaatagaccctgaaaatgaa
gaacttatgctgaacattagctctcgactacaagcagcagttgaaaaactcctagaagcc
ataagtgaaactagcagtcagcttgaacatgcgaaagtgacacagacagagttgatgcgt
gagtcatttagacagaaacaagaagcaacagagtcccttaagtgccaagaggaacttcga
gagcgccttcatgaggagtccagggccagagaacagctagctgtggagctcagtaaggct
gagggcgtcattgatggctatgcagatgaaaaaactctttttgaaaggcaaattcaggaa
aaaactgatataatagatcgtcttgagcaggagttgttatgtgcaagtaacaggttgcaa
gaattggaggcagagcaacagcagatccaagaagaaagagaattactgtccagacaaaag
gaagctatgaaagcagaggcaggcccagttgaacaacaattactacaggagacagaaaaa
ttaatgaaggaaaaactagaagtacaatgtcaagctgaaaaagtacgtgatgaccttcaa
aaacaagtgaaagctctagaaatagatgtggaagaacaagtcagtaggtttatagagctg
gaacaagaaaaaaatactgaactaatggatttaagacagcaaaaccaagcattggaaaag
cagttagaaaaaatgagaaaatttttagatgagcaagccattgacagagaacatgagaga
gatgtattccaacaggaaatacagaaactagaacagcaacttaaggttgttcctcgattc
cagcctatcagtgaacatcaaactagagaggttgaacagttagcaaatcatctgaaagaa
aaaacagacaaatgcagtgagcttttgctctctaaagagcagcttcaaagggatatacaa
gaaaggaatgaagaaatagagaaactggagttcagagtaagagaactggagcaggcgctt
cttgtgagtgcagatacttttcaaaaggtagaggaccgaaaacactttggagctgtagaa
gctaaaccagaattgtccctagaagtacaattgcaggctgaacgagatgccatagacaga
aaggaaaaagagattacaaacttagaagagcaattagaacagtttagagaagaactggaa
aataagaatgaagaagttcaacaattacatatgcaattagaaatacagaaaaaggaatct
actacccgcctacaagaacttgaacaggaaaacaaattatttaaggatgacatggagaaa
ctgggacttgccataaaggaatctgatgccatgtctactcaagaccaacatgtgctattt
gggaaatttgctcaaataatacaggaaaaagaggtagaaattgaccaattaaatgaacaa
gttacgaaactccagcagcaacttaaaattacaacagataacaaggttattgaagaaaaa
aatgaactgataagggatcttgaaacccaaatagaatgtttgatgagtgatcaagaatgt
gtgaagagaaatagagaagaagaaatagagcagctcaatgaagtgattgaaaaacttcaa
caggaattggcaaatattggacagaagacatcaatgaatgctcattccctctcagaagaa
gcagacagtttaaaacatcaattggatgtggttatagctgaaaagctggccttggaacag
caagtagaaaccgctaatgaagaaatgaccttcatgaaaaatgtacttaaagaaaccaat
tttaaaatgaatcagctaacacaggaattattcagcttaaagagagaacgtgaaagtgtg
gaaaagattcaaagcataccagagaatagtgttaacgtggctatagatcatctgagcaaa
gacaaacctgaactagaagtagtccttacagaggatgctcttaaatccctagaaaatcag
acatacttcaaatcttttgaagaaaatggcaaaggttccataattaatttggaaacaagg
ttgctacaacttgagagcactgttagtgcaaaggacttagaacttacccagtgttataaa
caaataaaagacatgcaagaacaaggccagtttgaaacagaaatgcttcaaaagaagatt
gtaaacctacagaaaatagttgaagaaaaagtggctgctgctcttgtcagtcaaatccaa
cttgaggcagttcaggaatatgcaaaattctgtcaagataatcaaacaatttcatcagaa
cctgaaagaacaaatattcagaatttaaatcaactaagagaagatgagttggggtcagat
atatcagcattaaccttgagaatatcagaattagaaagccaggttgttgaaatgcatact
agtttgattttagaaaaagaacaagtagaaattgcagaaaaaaatgttttagaaaaagaa
aagaagctgctagaactacagaagctattggagggcaatgagaaaaaacagagagagaaa
gaaaagaaaagaagccctcaagatgttgaagttctcaagacaactactgagctatttcat
agcaatgaagaaagtggattttttaatgaactcgaggctcttagagctgaatcagtggct
accaaagcagaacttgccagttataaagaaaaggctgaaaaacttcaagaagagcttttg
gtaaaagaaacaaatatgacatctcttcagaaagacttaagccaagttagggatcacctc
gcagaggcaaaagagaaattgtccattttagaaaaagaagatgagactgaggtacaagaa
agcaaaaaggcctgcatgtttgagccacttcctataaaactgagtaagagcattgcatcc
cagacagatgggactctgaagatcagtagcagcaatcagactccacaaattcttgttaaa
aatgcaggaatacaaattaatttacagagtgaatgttcctcagaagaagttactgaaata
atcagtcagtttactgaaaaaattgagaagatgcaagaactacatgctgctgaaattttg
gacatggaatccagacatatttcagaaactgaaaccttaaagagggaacactatgttgcc
gttcagttactgaaagaggaatgtggtaccttgaaggcagtgatacagtgtctgagaagt
aaagagggatcctcaattcctgagctagcacattctgatgcttaccagactagagaaata
tgctccagtgattctggatcagactggggtcagggaatttatcttacacacagtcaggga
tttgacatagcatcagaaggccgaggagaagaaagtgaaagtgcaacagattcctttcca
aagaaaataaagggattactgagagctgtccataatgaaggcatgcaggtgctttctctc
actgagtctccctatagtgatggagaggaccattctattcagcaggtttcagaaccttgg
ctagaagagagaaaagcttacatcaatacaatctcatctctaaaggatttaattacaaag
atgcaactgcaaagagaagccgaggtttatgatagttctcaatctcatgagagcttctca
gactggcgaggtgaactactgcttgcccttcaacaagttttcttagaagagcgtagtgtt
ttactagcagcatttcggacggagctgacagctctaggtactacagatgcagttggttta
ctaaactgtttggaacagagaatacaagaacagggtgttgaatatcaagcagctatggaa
tgcctccagaaagcagatagaaggagtttgttatctgaaattcaggcactgcatgcacaa
atgaatggtaggaaaattactctgaaaagagaacaagagagtgagaaaccaagccaagaa
ctcttggaatataatatacagcagaagcagtctcaaatgctggagatgcaagtggagctc
agcagtatgaaagacagagcaacggaactgcaggagcagctgagttctgagaaaatggtg
gttgctgaactgaagagtgagcttgcacaaactaaattggaactagaaacaacactcaag
gcacagcataaacacctaaaagaattggaggctttcaggttggaagttaaagataagaca
gatgaagtacatttgcttaatgacacattagcaagtgaacagaaaaaatcaagagagctc
cagtgggctttggagaaagagaaagccaagttgggacgcagtgaagaacgggataaagaa
gaacttgaggatctgaagttttcacttgagagtcagaaacaaaggaatcttcagctaaat
ctacttttggaacaacagaaacaactactgaacgaatcccagcaaaaaatagaatcacag
agaatgctatatgatgcccagttgtcagaagaacaaggtcgaaacttagagcttcaggta
cttcttgaatctgagaaagttcgaattcgggaaatgagtagtaccctagatagggagcgg
gaattgcacgcacagctgcagagcagtgatggtactggacagtctcggccacccttgccc
tcagaggacctactgaaagagctgcagaaacagctagaggaaaaacacagtcgcatagta
gaattgttaaatgagactgaaaaatataaactggattctttgcaaacacgacagcaaatg
gaaaaagataggcaggttcacaggaaaacactgcagacagaacaggaggccaacactgag
ggacagaaaaaaatgcatgagctccagtccaaagtggaagatcttcagcgccagctggaa
gagaaaagacaacaagtttataagttagaccttgaaggacagcgactacaaggaatcatg
caggaattccagaagcaagaactagaacgagaagaaaaacgagaaagtagaagaattctg
tatcagaaccttaatgagccaaccacgtggagcttaaccagtgatagaactagaaattgg
gttcttcaacagaaaatagaaggagaaacaaaagaatcaaactacgctaaattgattgaa
atgaatggaggaggaaccggctgtaatcatgaattagaaatgatcagacaaaagcttcaa
tgtgtagcttcaaaactacaggttctaccccagaaagcctctgagagactacagtttgaa
acagcagatgatgaagatttcatttgggttcaggaaaatattgatgaaattattttacaa
ctacagaaattaactggccagcaaggtgaagagcccagcttggtgtccccaagtacttct
tgtggctcattgactgaaagactactgagacaaaatgctgagctgacagggcatatcagt
caactgactgaagagaagaatgacttaaggaacatggttatgaagctggaagagcagatc
aggtggtatcgacagacaggagctggtagagataattcttccaggttttcattgaatggt
ggtgccaacattgaagccatcattgcctctgaaaaagaagtatggaacagagaaaaattg
actctccagaaatctttgaaaagggcagaggctgaagtatacaaactgaaagctgaacta
agaaatgactctttacttcaaactctgagccctgattctgaacatgtcactttaaagaga
atttatggtaaatacttgagggcagaaagttttcgaaaggctctcatttaccagaagaaa
tacctgctgctgttactgggtgggttccaggaatgtgaagatgccaccttggccctgctt
gcccggatgggggggcagccagctttcacggatctagaggtgatcaccaatcgcccaaag
ggcttcaccaggtttcggtcggccgtcagagtatccattgcaatttccagaatgaaattt
ttggttcgacggtggcatcgagtcacaggttctgtttccatcaatattaacagagatggc
tttggactgaatcaaggtgcagaaaagactgactcattttatcattcttctggtgggctg
gagttatatggagaaccaagacatactacgtatcgctcaagatcagatctggactatatt
aggtcccctttaccatttcagaataggtacccaggcactccagctgatttcaatcctggt
tctttagcatgttctcagcttcagaattacgatcctgacagagccctaacagattatatc
actcggctagaggcactgcaaagacgacttggaactatacagtcaggttcaactactcaa
tttcatgctggcatgagaagataa

DBGET integrated database retrieval system