KEGG   Homo sapiens (human): 10157Help
Entry
10157             CDS       T01001                                 

Gene name
AASS, LKR/SDH, LKRSDH, LORSDH
Definition
(RefSeq) aminoadipate-semialdehyde synthase
  KO
K14157  alpha-aminoadipic semialdehyde synthase [EC:1.5.1.8 1.5.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
Module
hsa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Disease
H00188  Hyperlysinemia
H01242  Saccharopinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    10157 (AASS)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.8  saccharopine dehydrogenase (NADP+, L-lysine-forming)
     10157 (AASS)
    1.5.1.9  saccharopine dehydrogenase (NAD+, L-glutamate-forming)
     10157 (AASS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sacchrp_dh_C AlaDh_PNT_N Sacchrp_dh_NADP AlaDh_PNT_C Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 10157
NCBI-ProteinID: NP_005754
OMIM: 605113
HGNC: 17366
Ensembl: ENSG00000008311
Vega: OTTHUMG00000157058
Pharos: Q9UDR5(Tbio)
UniProt: Q9UDR5 A4D0W4
Structure
PDB: 

Position
7q31.32
AA seq 926 aa AA seqDB search
MLQVHRTGLGRLGVSLSKGLHHKAVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQ
PSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEEKLMSRKTYAFFSHTIKAQEANM
GLLDEILKQEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFM
HIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQAIFNELPC
EYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYDPAEYDKHPERYISRFNTDIA
PYTTCLINGIYWEQNTPRLLTRQDAQSLLAPGKFSPAGVEGCPALPHKLVAICDISADTG
GSIEFMTECTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLY
PYVEEMILSDATQPLESQNFSPVVRDAVITSNGTLPDKYKYIQTLRESRERAQSLSMGTR
RKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYNINPVSMDICKQEEKL
GFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGE
LGLDPGLDHMLAMETIDKAKEVGATIESYISYCGGLPAPEHSNNPLRYKFSWSPVGVLMN
VMQSATYLLDGKVVNVAGGISFLDAVTSMDFFPGLNLEGYPNRDSTKYAEIYGISSAHTL
LRGTLRYKGYMKALNGFVKLGLINREALPAFRPEANPLTWKQLLCDLVGISPSSEHDVLK
EAVLKKLGGDNTQLEAAEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRD
SFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAKGLMGPFS
KEIYGPILERIKAEGIIYTTQSTIKP
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagtacataggactggactgggcaggctgggggtcagcctctccaagggtctt
caccacaaagctgtgttggccgtccggagggaggatgtgaacgcctgggagagaagggcc
ccgctagctcccaagcacatcaaaggcatcaccaatctgggatacaaggtcttgatacag
ccttcgaatcggcgggccattcatgataaggactatgtcaaagctggtggcattcttcag
gaggatatttctgaagcttgtctaattttaggagttaaaagacctccagaggaaaaatta
atgtccaggaagacttatgcatttttctcccacacaataaaagctcaggaggccaatatg
ggcttgttggatgagattctaaaacaggaaattcgccttattgattatgagaaaatggtg
gatcatagaggagtacgggtagtggcatttggacagtgggctggtgtggcaggaatgatc
aacattttacatggaatgggtttaaggctccttgctttgggacatcacacaccttttatg
cacattggcatggctcataactacaggaatagcagtcaggctgtgcaagctgtccgtgat
gctggctatgaaatatctttgggtttgatgcctaagtcaataggacccttaacatttgtg
ttcacaggaactggtaatgtttctaagggagcccaagcaatctttaatgagctaccttgt
gaatatgtggagccccatgaattaaaagaagtttcccaaactggagacctcagaaaagtg
tatgggacggtgttaagtcgtcatcatcatcttgtcaggaaaacagatgctgtgtatgat
cctgcagagtatgacaaacatccggagcgctacataagtcgttttaatactgatattgca
ccctatacaacttgcttaattaatggaatctactgggaacaaaacactcctcgcctccta
acccgccaagatgctcagagtctcctggctccgggcaagttctcacctgctggtgtggaa
ggctgccctgcattaccacacaaactcgtggcaatatgtgacatttcagctgacacagga
gggtctatagagtttatgactgagtgtacaacaatagagcatcccttttgcatgtatgat
gcagaccagcatattattcatgacagtgttgaaggctcggggatcctgatgtgttccatt
gacaatttgccggcacagctcccaattgaagctacagaatgctttggagacatgctttac
ccttatgttgaagaaatgatattatcagacgcgacacagcctcttgaaagtcagaatttt
tctcctgtggtgagagatgcagtgattacatccaacggtacattacctgataaatataaa
tatatccagacactccgggagagcagggaacgtgctcagtcactttcaatgggcaccagg
agaaaggttttggttcttggatctggctacatatctgagcctgtattagaatatttatca
agagatggcaatatagaaataacagtaggatctgacatgaagaatcaaattgaacagtta
ggcaagaaatataatattaatcctgttagcatggacatttgtaaacaagaagagaagctg
ggcttcttggtggcaaaacaggatcttgtcatcagcttgttgccttatgtattgcaccct
cttgtggccaaggcctgcatcacaaacaaagttaacatggtcactgcaagctacatcaca
ccagcactaaaagaattggaaaagagtgtggaagatgctggcatcacaatcattggtgaa
ttgggattggaccctggtctggatcacatgttagcaatggaaacaatagataaagccaag
gaagtgggagccacgattgaatcatatatttcctactgtggtgggcttccagcccctgaa
cattcaaacaatccattgagatataaatttagctggagtccagtgggagttttgatgaat
gtaatgcagtctgccacctatctgctcgatggaaaggttgtgaatgttgcaggaggcatc
tcctttcttgatgccgttacgtccatggatttttttccaggattaaatttggaaggctat
cctaacagagacagtacgaaatatgctgagatttatggcatttcttctgctcacactttg
ttgcgggggacactgagatataagggatatatgaaagctttgaatggatttgtaaaatta
ggtcttataaacagagaagcgcttcctgcctttagacctgaggccaaccctctcacctgg
aaacaactcctctgtgacctagttgggatttcaccctcctctgagcatgatgtgttgaag
gaagctgttcttaagaaactaggaggagacaatacccagttggaggctgctgaatggttg
ggcttacttggggatgaacaagttcctcaggcagagtccattctggatgccctctccaag
catttggtcatgaagctttcctatggtcctgaagaaaaagatatgattgtgatgagagac
agctttggaatcagacatccttctggacatttagaacataaaacgattgatcttgtggct
tatggggacatcaatggcttttcagccatggctaaaaccgtggggttacccaccgccatg
gcagccaaaatgttgcttgatggtgaaattggagccaaaggcctaatggggcccttttca
aaggagatctatggaccaatattggagcgaattaaagcagaaggcattatatatactaca
cagagtacaattaaaccataa

DBGET integrated database retrieval system