KEGG   Homo sapiens (human): 10199Help
Entry
10199             CDS       T01001                                 

Gene name
MPHOSPH10, CT90, MPP10, MPP10P, PPP1R106
Definition
(RefSeq) M-phase phosphoprotein 10
  KO
K14559  U3 small nucleolar RNA-associated protein MPP10
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    10199 (MPHOSPH10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10199 (MPHOSPH10)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    10199 (MPHOSPH10)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10199 (MPHOSPH10)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    10199 (MPHOSPH10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mpp10
Motif
Other DBs
NCBI-GeneID: 10199
NCBI-ProteinID: NP_005782
OMIM: 605503
HGNC: 7213
Ensembl: ENSG00000124383
Vega: OTTHUMG00000129715
Pharos: O00566(Tbio)
UniProt: O00566
Position
2p13.3
AA seq 681 aa AA seqDB search
MAPQVWRRRTLERCLTEVGKATGRPECFLTIQEGLASKFTSLTKVLYDFNKILENGRIHG
SPLQKLVIENFDDEQIWQQLELQNEPILQYFQNAVSETINDEDISLLPESEEQEREEDGS
EIEADDKEDLEDLEEEEVSDMGNDDPEMGERAENSSKSDLRKSPVFSDEDSDLDFDISKL
EQQSKVQNKGQGKPREKSIVDDKFFKLSEMEAYLENIEKEEERKDDNDEEEEDIDFFEDI
DSDEDEGGLFGSKKLKSGKSSRNLKYKDFFDPVESDEDITNVHDDELDSNKEDDEIAEEE
AEELSISETDEDDDLQENEDNKQHKESLKRVTFALPDDAETEDTGVLNVKKNSDEVKSSF
EKRQEKMNEKIASLEKELLEKKPWQLQGEVTAQKRPENSLLEETLHFDHAVRMAPVITEE
TTLQLEDIIKQRIRDQAWDDVVRKEKPKEDAYEYKKRLTLDHEKSKLSLAEIYEQEYIKL
NQQKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAP
VSVSDAALLAPEEIKEKNKAGDIKTAAEKTATDKKRERRKKKYQKRMKIKEKEKRRKLLE
KSSVDQAGKYSKTVASEKLKQLTKTGKASFIKDEGKDKALKSSQAFFSKLQDQVKMQIND
AKKTEKKKKKRQDISVHKLKL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcaggtctggcgtcgacggaccctggagcggtgtctgacggaagtcggcaaa
gccacgggtcggcccgagtgcttcctcacgattcaagagggattggcatcaaagttcact
tctttaacaaaagtgctttatgactttaataaaatattagagaatggtaggatccatgga
agccccttgcaaaaacttgtgatagaaaattttgatgatgagcagatttggcaacaactg
gaattgcaaaatgaaccaattttacaatactttcagaatgcagttagtgaaacaattaat
gatgaagatatcagtcttctcccagagagtgaagaacaggaacgtgaagaggatggttca
gagatagaggctgatgacaaggaggacctagaagatttagaggaggaggaagtgtccgac
atgggtaatgatgatcctgaaatgggtgagagagctgaaaactcaagcaaatctgatctg
aggaaaagccccgttttcagtgatgaggattctgaccttgactttgatatcagcaaattg
gaacagcagagcaaggtgcaaaacaaaggacagggaaaaccaagagaaaagtccatagta
gatgataaattcttcaaactctctgaaatggaggcctatttagaaaacatagaaaaagaa
gaggaacgaaaagatgataatgatgaggaggaggaagatattgatttttttgaagatatt
gattctgatgaagatgaagggggactgtttggaagtaaaaaacttaagtcaggtaaaagt
tccagaaatctgaaatacaaagatttttttgatccagttgaaagtgatgaagacataaca
aatgttcatgatgatgagctggattcaaacaaagaagatgatgaaattgctgaagaagaa
gcagaagaactaagtatttcggaaacggatgaagatgatgaccttcaagaaaatgaagac
aataaacaacataaagaaagcttgaaaagagtgacctttgctttaccagatgatgcggaa
actgaagatacaggtgttttaaatgtaaagaaaaattctgatgaagttaaatcctccttt
gaaaaaagacaggaaaagatgaatgaaaaaattgcatctttagaaaaagagttgttagaa
aaaaagccgtggcagcttcagggggaagtgacagcacagaagaggccagagaacagcctc
ctggaggagaccctacactttgaccatgctgtccggatggcacctgtgattacagaggaa
accacccttcaactggaagatatcattaaacagaggataagagatcaggcttgggatgat
gtagtacgtaaagaaaaacctaaagaggatgcatatgaatataaaaagcgtttaacctta
gaccatgagaagagtaaattgagccttgctgaaatttatgaacaggagtacatcaaactc
aaccagcaaaaaacagcagaagaagaaaatccagaacatgtagaaattcagaagatgatg
gattccctcttcttaaaattggatgccctctcaaacttccactttatccctaaaccgcct
gtaccagagattaaagttgtgtcaaatctgccagccataaccatggaggaagtagcccca
gtgagtgttagtgatgcagctctcctggccccagaggagatcaaggagaaaaataaagct
ggagatataaaaacagctgctgaaaaaacagctacagacaagaaacgagagcgaaggaaa
aagaaatatcaaaagcgtatgaaaataaaagagaaggagaagcggagaaaactgcttgaa
aagagcagtgtagatcaagcagggaaatacagcaaaacagtagcttcggagaagttaaaa
cagctgaccaaaactggcaaagcttccttcataaaggatgaaggtaaagacaaggcctta
aagtcctctcaagcattcttttctaaattacaagatcaagtaaaaatgcaaatcaatgat
gcaaagaaaacagaaaagaaaaagaagaaaagacaggatatttctgttcataaattaaag
ctgtaa

DBGET integrated database retrieval system