KEGG   Homo sapiens (human): 10483Help
Entry
10483             CDS       T01001                                 

Gene name
SEC23B, CDA-II, CDAII, CDAN2, CWS7, HEMPAS, hSec23B
Definition
(RefSeq) Sec23 homolog B, coat complex II component
  KO
K14006  protein transport protein SEC23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00404  COPII complex
Disease
H00917  Congenital dyserythropoietic anemias (CDAs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10483 (SEC23B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    10483 (SEC23B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical Gelsolin zf-Sec23_Sec24
Motif
Other DBs
NCBI-GeneID: 10483
NCBI-ProteinID: NP_001166216
OMIM: 610512
HGNC: 10702
Ensembl: ENSG00000101310
Vega: OTTHUMG00000031976
Pharos: Q15437(Tbio)
UniProt: Q15437
Position
20p11.23
AA seq 767 aa AA seqDB search
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYV
IQRGAQSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDM
NLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP
GMVVGDELKIPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIYACALDQTGLL
EMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKDFNGDFRMAFGATLDVKTSRELKIAG
AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNTPIPQGGRGA
IQFVTHYQHSSTQRRIRVTTIARNWADVQSQLRHIEAAFDQEAAAVLMARLGVFRAESEE
GPDVLRWLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFL
LSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggcgacatacctggagttcatccagcagaatgaagaacgggatggtgtgcgttttagt
tggaacgtgtggccttccagccggctggaggctacaagaatggttgtacccctggcttgt
ctccttactcctttgaaagaacgtccagacctacctcctgtacaatatgaacctgtgctt
tgcagcaggccaacttgtaaagctgttctcaacccactttgtcaggttgattatcgagca
aaactttgggcctgtaatttctgttttcaaagaaatcagtttcctccagcttatggaggc
atatctgaggtgaatcaacctgccgaattgatgccccagttttctacaattgagtacgtg
atacagcgaggtgctcagtcccctctgatctttctctatgtggttgacacatgcctggag
gaagatgaccttcaagcactcaaagagtccctgcagatgtccctgagtcttcttcctcca
gatgctctggtgggtctgatcacatttggaaggatggtgcaggttcatgagctaagctgt
gaaggaatctccaaaagttatgtcttccgagggaccaaggatttaactgcaaagcaaata
caggatatgttgggcctgaccaagccagccatgcccatgcagcaagcacgacctgcacaa
ccacaggagcacccttttgcttcaagcagatttctgcagcctgttcacaagattgatatg
aacctcactgatcttcttggggagctacagagggacccatggccagtaactcaggggaag
agacctttgcgatccactggtgtggctttgtccattgctgttggcttgctggagggcact
tttccaaacacaggagccaggatcatgctgtttactggaggtccccctacccaagggcct
ggcatggtggttggagatgaattaaagattcctattcgttcttggcatgatattgagaaa
gataatgcacgattcatgaaaaaggcaaccaagcactatgagatgcttgctaatcgaaca
gctgcaaatggtcactgcattgatatttatgcttgtgcccttgatcaaactggacttttg
gagatgaagtgttgtgcaaatcttactggaggctacatggtaatgggagattctttcaac
acttctctcttcaagcagacattccaaagaatctttactaaagattttaatggagatttc
cgaatggcatttggtgctactttggacgtaaagacctctcgggaactgaagattgcagga
gccattggtccatgcgtatctctgaatgtgaaaggaccgtgtgtgtcagaaaatgagctt
ggtgttggtggcacgagtcagtggaaaatctgtggcctagatcctacatctacacttggc
atctattttgaagttgtcaatcagcacaacaccccgatcccccaaggaggcagaggagcc
atccagtttgtcacgcattatcagcactccagcacccagagacgcatccgcgtgaccacc
atcgcccgaaattgggcagatgtacagagtcagctcaggcacatagaagcagcatttgac
caggaggctgcggcagtgttgatggcacggcttggggtgttccgagcggagtcagaggag
gggcccgatgtgctccggtggctggaccgacaactcatccgactgtgtcaaaagtttgga
cagtataacaaagaagaccccacttcttttaggttatcagattccttttctctatatcct
cagtttatgttccatctgagaagatctccatttcttcaagtgtttaacaacagtcctgat
gagtcgtcatattacagacatcattttgcccggcaggacctgacccagtccctcatcatg
atccagcccattctctactcttactcctttcatgggccaccagagccagtactcttggat
agcagcagcattctagctgacagaattttgctgatggatactttctttcaaattgtcatt
tatcttggtgagaccatagcccagtggcgtaaagctggctaccaggacatgcccgagtat
gaaaacttcaagcaccttctgcaggcaccactggatgatgctcaagaaattctgcaagca
cgcttcccgatgccacgttacatcaacacggagcatggaggcagtcaggctcgattcctt
ttgtccaaagtgaacccatctcagacacacaataacctgtatgcttggggacaggaaact
ggagcacccatcctaactgatgatgttagcctgcaggtgttcatggaccatttgaagaag
ctggctgtctccagtgcctgttaa

DBGET integrated database retrieval system