KEGG   Homo sapiens (human): 10487
Entry
10487             CDS       T01001                                 

Symbol
CAP1, CAP, CAP1-PEN
Name
(RefSeq) cyclase associated actin cytoskeleton regulatory protein 1
  KO
K17261  adenylyl cyclase-associated protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10487 (CAP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10487 (CAP1)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    10487 (CAP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10487 (CAP1)
SSDB
Motif
Pfam: CAP_C CAP_N TBCC Spc29
Other DBs
NCBI-GeneID: 10487
NCBI-ProteinID: NP_001099000
OMIM: 617801
HGNC: 20040
Ensembl: ENSG00000131236
Vega: OTTHUMG00000004493
Pharos: Q01518(Tbio)
UniProt: Q01518 D3DPU2
Structure
Position
1:40040240..40072648
AA seq 475 aa
MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLK
ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPP
PVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPF
SAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTT
LQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctgacatgcaaaatctggtagaaagattggagagggcagtgggccgcctggaggca
gtatctcatacctctgacatgcaccgtgggtatgcagacagtccttcaaaagcaggagca
gctccatatgtgcaggcatttgactcgctgcttgctggtcctgtggcagagtacttgaag
atcagtaaagagattgggggagacgtgcagaaacatgcggagatggtccacacaggtttg
aagttggagcgagctctgttggttacagcttctcagtgtcaacagccagcagaaaataag
ctttccgatttgttggcacccatctcagagcagatcaaagaagtgataacctttcgggag
aagaaccgaggcagcaagttgtttaatcacctgtcagctgtcagcgaaagtatccaggcc
ctgggctgggtggctatggctcccaagcctggcccttatgtgaaagaaatgaatgatgcc
gccatgttttatacaaaccgagtcctcaaagagtacaaagatgtggataagaagcatgta
gactgggtcaaagcttatttaagtatatggacagagctgcaggcttacattaaggagttc
cataccaccggactggcctggagcaaaacggggcctgtggcaaaagaactgagcggactg
ccatctggaccctctgccggatcatgtcctcctccccctccaccatgcccccctcctccc
ccagtctctaccatttcatgctcatatgagtctgcttcccgctcatcactgttcgcgcag
attaatcagggggagagcattacacatgccctgaaacatgtatctgatgacatgaagact
cacaagaaccctgccctgaaggctcagagtggtccagtacgcagtggccccaaaccattc
tctgcacctaaaccccaaaccagcccatcccccaaacgagccacaaagaaggagccagct
gtacttgaactggagggcaagaagtggagagtggaaaatcaggaaaatgtttccaacctg
gtgattgaggacacagagctgaaacaggtggcttacatatacaagtgtgtcaacacgaca
ttgcaaatcaagggcaaaattaactccattacagtagataactgtaagaaacttggcctg
gtattcgatgacgtggtgggcattgtggagataatcaacagtaaggatgtcaaagttcag
gtaatgggtaaagtgccaaccatatccatcaacaaaacagatggctgccatgcttacctg
agcaagaattccctggattgtgaaatagtcagtgccaaatcttccgagatgaatgtcctc
attcctacagaaggcggtgactttaatgaattcccagttcctgagcagttcaagacccta
tggaacgggcagaagttggtcaccacagtgacagaaattgctggataa

DBGET integrated database retrieval system