KEGG   Homo sapiens (human): 10683Help
Entry
10683             CDS       T01001                                 

Gene name
DLL3, SCDO1
Definition
(RefSeq) delta like canonical Notch ligand 3
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Module
hsa_M00682  Notch signaling
Network
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
Disease
H00517  Spondylocostal dysostosis (SCD)
Drug target
Rovalpituzumab tesirine: D10981
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    10683 (DLL3)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    10683 (DLL3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10683 (DLL3)
   05224 Breast cancer
    10683 (DLL3)
  Drug resistance
   01522 Endocrine resistance
    10683 (DLL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_2 DSL
Motif
Other DBs
NCBI-GeneID: 10683
NCBI-ProteinID: NP_058637
OMIM: 602768
HGNC: 2909
Ensembl: ENSG00000090932
Vega: OTTHUMG00000183067
Pharos: Q9NYJ7(Tbio)
UniProt: Q9NYJ7
Position
19q13.2
AA seq 618 aa AA seqDB search
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP
PAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA
GQRQHLLFPYPSSILSVK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggtctccccacggatgtccgggctcctctcccagactgtgatcctagcgctcattttc
ctcccccagacacggcccgctggcgtcttcgagctgcagatccactctttcgggccgggt
ccaggccctggggccccgcggtccccctgcagcgcccggctcccctgccgcctcttcttc
agagtctgcctgaagcctgggctctcagaggaggccgccgagtccccgtgcgccctgggc
gcggcgctgagtgcgcgcggaccggtctacaccgagcagcccggagcgcccgcgcctgat
ctcccactgcccgacggcctcttgcaggtgcccttccgggacgcctggcctggcaccttc
tctttcatcatcgaaacctggagagaggagttaggagaccagattggagggcccgcctgg
agcctgctggcgcgcgtggctggcaggcggcgcttggcagccggaggcccgtgggcccgg
gacattcagcgcgcaggcgcctgggagctgcgcttctcgtaccgcgcgcgctgcgagccg
cctgccgtcgggaccgcgtgcacgcgcctctgccgtccgcgcagcgccccctcgcggtgc
ggtccgggactgcgcccctgcgcaccgctcgaggacgaatgtgaggcgccgctggtgtgc
cgagcaggctgcagccctgagcatggcttctgtgaacagcccggtgaatgccgatgccta
gagggctggactggacccctctgcacggtccctgtctccaccagcagctgcctcagcccc
aggggcccgtcctctgctaccaccggatgccttgtccctgggcctgggccctgtgacggg
aacccgtgtgccaatggaggcagctgtagtgagacacccaggtcctttgaatgcacctgc
ccgcgtgggttctacgggctgcggtgtgaggtgagcggggtgacatgtgcagatggaccc
tgcttcaacggcggcttgtgtgtcgggggtgcagaccctgactctgcctacatctgccac
tgcccacccggtttccaaggctccaactgtgagaagagggtggaccggtgcagcctgcag
ccatgccgcaatggcggactctgcctggacctgggccacgccctgcgctgccgctgccgc
gccggcttcgcgggtcctcgctgcgagcacgacctggacgactgcgcgggccgcgcctgc
gctaacggcggcacgtgtgtggagggcggcggcgcgcaccgctgctcctgcgcgctgggc
ttcggcggccgcgactgccgcgagcgcgcggacccgtgcgccgcgcgcccctgtgctcac
ggcggccgctgctacgcccacttctccggcctcgtctgcgcttgcgctcccggctacatg
ggagcgcggtgtgagttcccagtgcaccccgacggcgcaagcgccttgcccgcggccccg
ccgggcctcaggcccggggaccctcagcgctaccttttgcctccggctctgggactgctc
gtggccgcgggcgtggccggcgctgcgctcttgctggtccacgtgcgccgccgtggccac
tcccaggatgctgggtctcgcttgctggctgggaccccggagccgtcagtccacgcactc
ccggatgcactcaacaacctaaggacgcaggagggttccggggatggtccgagctcgtcc
gtagattggaatcgccctgaagatgtagaccctcaagggatttatgtcatatctgctcct
tccatctacgctcgggaggtagcgacgccccttttccccccgctacacactgggcgcgct
gggcagaggcagcacctgctttttccctacccttcctcgattctgtccgtgaaatga

DBGET integrated database retrieval system