KEGG   Homo sapiens (human): 11240Help
Entry
11240             CDS       T01001                                 

Gene name
PADI2, PAD-H19, PAD2, PDI2
Definition
(RefSeq) peptidyl arginine deiminase 2
  KO
K01481  protein-arginine deiminase [EC:3.5.3.15]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    11240 (PADI2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     11240 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAD PAD_M PAD_N
Motif
Other DBs
NCBI-GeneID: 11240
NCBI-ProteinID: NP_031391
OMIM: 607935
HGNC: 18341
Ensembl: ENSG00000117115
Vega: OTTHUMG00000002295
Pharos: Q9Y2J8(Tchem)
UniProt: Q9Y2J8 A0A024RA98
Structure
PDB: 

Position
1p36.13
AA seq 665 aa AA seqDB search
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgagcggaccgtgcggctgcagtacgggagccgcgtggaggcggtgtacgtg
ctgggcacctacctctggaccgatgtctacagcgcggccccagccggggcccaaaccttc
agcctgaagcactcggaacacgtgtgggtggaggtggtgcgtgatggggaggctgaggag
gtggccaccaatggcaagcagcgctggcttctctcgcccagcaccaccctgcgggtcacc
atgagccaggcgagcaccgaggccagcagtgacaaggtcaccgtcaactactatgacgag
gaagggagcattcccatcgaccaggcggggctcttcctcacagccattgagatctccctg
gatgtggacgcagaccgggatggtgtggtggagaagaacaacccaaagaaggcatcctgg
acctggggccccgagggccagggggccatcctgctggtgaactgtgaccgagagacaccc
tggttgcccaaggaggactgccgtgatgagaaggtctacagcaaggaagatctcaaggac
atgtcccagatgatcctgcggaccaaaggccccgaccgcctccccgccggatacgagata
gttctgtacatttccatgtcagactcagacaaagtgggcgtgttctacgtggagaacccg
ttcttcggccaacgctatatccacatcctgggccggcggaagctctaccatgtggtcaag
tacacgggtggctccgcggagctgctgttcttcgtggaaggcctctgtttccccgacgag
ggcttctcaggcctggtctccatccatgtcagcctgctggagtacatggcccaggacatt
cccctgactcccatcttcacggacaccgtgatattccggattgctccgtggatcatgacc
cccaacatcctgcctcccgtgtcggtgtttgtgtgctgcatgaaggataattacctgttc
ctgaaagaggtgaagaaccttgtggagaaaaccaactgtgagctgaaggtctgcttccag
tacctaaaccgaggcgatcgctggatccaggatgaaattgagtttggctacatcgaggcc
ccccataaaggcttccccgtggtgctggactctccccgagatggaaacctaaaggacttc
cctgtgaaggagctcctgggcccagattttggctacgtgacccgggagcccctctttgag
tctgtcaccagccttgactcatttggaaacctggaggtcagtcccccagtgaccgtgaac
ggcaagacatacccgcttggccgcatcctcatcgggagcagctttcctctgtctggtggt
cggaggatgaccaaggtggtgcgtgacttcctgaaggcccagcaggtgcaggcgcccgtg
gagctctactcagactggctgactgtgggccacgtggatgagttcatgtcctttgtcccc
atccccggcacaaagaaattcctgctactcatggccagcacctcggcctgctacaagctc
ttccgagagaagcagaaggacggccatggagaggccatcatgttcaaaggcttgggtggg
atgagcagcaagcgaatcaccatcaacaagattctgtccaacgagagccttgtgcaggag
aacctgtacttccagcgctgcctagactggaaccgtgacatcctcaagaaggagctggga
ctgacagagcaggacatcattgacctgcccgctctgttcaagatggacgaggaccaccgt
gccagagccttcttcccaaacatggtgaacatgatcgtgctggacaaggacctgggcatc
cccaagccattcgggccacaggttgaggaggaatgctgcctggagatgcacgtgcgtggc
ctcctggagcccctgggcctcgaatgcaccttcatcgacgacatttctgcctaccacaaa
tttctgggggaagtccactgtggcaccaacgtccgcaggaagcccttcaccttcaagtgg
tggcacatggtgccctga

DBGET integrated database retrieval system