KEGG   Homo sapiens (human): 11275Help
Entry
11275             CDS       T01001                                 

Gene name
KLHL2, ABP-KELCH, MAV, MAYVEN
Definition
(RefSeq) kelch like family member 2
  KO
K10443  kelch-like protein 2/3
Organism
hsa  Homo sapiens (human)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     11275 (KLHL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 BACK BTB Kelch_2 Kelch_3 Kelch_4
Motif
Other DBs
NCBI-GeneID: 11275
NCBI-ProteinID: NP_009177
OMIM: 605774
HGNC: 6353
Ensembl: ENSG00000109466
Vega: OTTHUMG00000161294
Pharos: O95198(Tbio)
UniProt: O95198
Structure
PDB: 

Position
4q32.3
AA seq 593 aa AA seqDB search
METPPLPPACTKQGHQKPLDSKDDNTEKHCPVTVNPWHMKKAFKVMNELRSQNLLCDVTI
VAEDMEISAHRVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYVYTAEIQ
VTEENVQVLLPAAGLLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTY
AEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVNHDKDVRQEFMAR
LMEHVRLPLLPREYLVQRVEEEALVKNSSACKDYLIEAMKYHLLPTEQRILMKSVRTRLR
TPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYMAGLVFAVGG
FNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAY
NIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDGASRQCLSTVECYNATTNEWTYIA
EMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCA
VNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKPL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggagacgccgccgctgcctcccgcatgcacaaagcagggtcatcagaagcctctcgat
tcaaaagatgataataccgaaaaacactgcccagtgacagtgaatccttggcatatgaag
aaagctttcaaagtcatgaacgaattaagaagtcaaaatttgctgtgcgatgtcacaatt
gtggcagaagacatggaaatttctgctcatagagtggtgctggccgcctgtagtccttat
tttcatgccatgtttacaggtgagatgagtgagagccgagcaaagagagttagaataaaa
gaggtagatggctggaccctgaggatgctaattgattatgtttacactgcagaaattcag
gttacagaagaaaatgtacaggtacttctcccagcagctggtctcttacagttacaggat
gtgaagaagacttgttgtgaatttttggaatcccagcttcaccctgtcaactgcttagga
atccgggcttttgctgatatgcatgcatgtaccgaccttctgaacaaggccaacacctat
gcagagcaacattttgcagatgttgtacttagtgaagaatttctcaatcttggcatcgaa
caagtgtgcagcttaatctcaagtgacaaacttaccatttcttcagaagagaaggtattt
gaagcagtaatagcatgggtgaaccatgacaaggatgtgaggcaagagtttatggcccga
ctgatggaacatgtacggttacctttgcttcctcgggaatatttagttcagagggttgaa
gaggaagcattggtcaagaatagcagtgcttgcaaagattacctcattgaagcaatgaag
taccatttgctgccaacagagcagcgtatattaatgaagagtgtccggacccggctgagg
acacccatgaaccttcccaaattgatggtggtggttgggggccaagcaccaaaggctatc
cggagtgtggaatgctatgactttaaagaagaaaggtggcaccaagtagcagagttgcct
tccaggaggtgcagggcaggcatggtctacatggctggacttgtttttgctgttggtggc
tttaatggctcattaagagttcgcactgtagattcctacgaccctgtgaaggaccagtgg
accagcgttgctaacatgagagaccggagaagcactttgggagctgctgtgttaaatgga
ttattatacgctgtgggaggctttgatgggagtacaggtttgtcatctgtggaagcatac
aacataaagtctaatgagtggtttcatgtagctcccatgaatacaaggaggagcagtgtt
ggtgtgggtgttgttggaggtttgctctatgctgtaggaggttatgatggagcatcacgt
cagtgtcttagcacagtagaatgctataatgctacaacaaatgagtggacctatatagca
gaaatgagcaccaggcggagtggagcaggtgttggtgtgttaaacaatttattgtatgct
gtaggaggtcatgatggccctttagtacgaaaaagtgttgaagtatatgatcccaccact
aacgcatggagacaggttgcagatatgaacatgtgcagaagaaatgcaggagtttgtgca
gttaatggtctgttatatgttgttggaggggatgatggttcctgtaacttggcgtcagta
gaatattataacccaacaaccgataaatggacagttgtgtcatcgtgtatgagcacaggg
agaagttatgcaggggtcacagttattgataaaccattatga

DBGET integrated database retrieval system