KEGG   Homo sapiens (human): 113419Help
Entry
113419            CDS       T01001                                 

Gene name
TEX261, TEG-261
Definition
(RefSeq) testis expressed 261
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Erv26
Motif
Other DBs
NCBI-GeneID: 113419
NCBI-ProteinID: NP_653183
OMIM: 618562
HGNC: 30712
Ensembl: ENSG00000144043
Vega: OTTHUMG00000170601
Pharos: Q6UWH6(Tdark)
UniProt: Q6UWH6
Position
2p13.3
AA seq 196 aa AA seqDB search
MWFMYLLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLY
VFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYY
PFSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGDDVVSNYFTKGKRGKRLGILVV
FSFIKEAILPSRQKIY
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcatgtacctgctgagctggctgtcgctcttcatccaggtggccttcatcacg
ctggctgtcgcggctggactctattacctggcagaactgatagaagaatacacagtggcc
accagcaggatcataaaatacatgatctggttctccaccgctgtactgattggcctctac
gtctttgagcgcttccccaccagcatgattggagtgggcctattcaccaacctcgtctac
tttggcctcctccagaccttccccttcatcatgctgacctcgcctaacttcatcctgtcg
tgtggactagtggtggtgaatcattacctagcatttcagttttttgcagaagaatattat
cccttctcagaggtcctggcctatttcactttctgcctgtggataattccgtttgcgttt
tttgtgtcactttcggccggggagaacgtcctgccctctaccatgcagccaggagatgat
gtcgtctccaattatttcaccaaaggcaagcggggcaaacgcttagggatcctggttgtc
ttctccttcatcaaagaggccattctacccagtcgtcagaagatatactga

DBGET integrated database retrieval system