KEGG   Homo sapiens (human): 114659Help
Entry
114659            CDS       T01001                                 

Gene name
LRRC37B, LRRC37
Definition
(RefSeq) leucine rich repeat containing 37B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LRRC37AB_C LRRC37 LRR_8 LRR_4 LRR_9 LRR_5 TMEM154 Orf78 Sarcoglycan_2 Synaptobrevin Seryl_tRNA_N Myc_target_1 Arm_vescicular PilO
Motif
Other DBs
NCBI-GeneID: 114659
NCBI-ProteinID: NP_443120
OMIM: 616558
HGNC: 29070
Ensembl: ENSG00000185158
Vega: OTTHUMG00000132785
Pharos: Q96QE4(Tdark)
UniProt: Q96QE4
Position
17q11.2
AA seq 947 aa AA seqDB search
MSWLRFWGPWPLLTWQLLSLLVKEAQPLVWVKDPLQLTSNPLGPPEPWSSRSSHLPWESP
HAPAPPAAPGDFDYLGPSASSQMSALPQEPTENLAPFLKELDSAGELPLGPEPFLAAHQD
LNDKRTPEERLPEVVPLLNRDQNQALVQLPRLKWVQTTDLDRAAGHQADEILVPLDSKVS
RPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLSMDTLYPGSLPPE
LRVNADEPPGPPEQVGLSQFHLEPKSQNPETLEDIQSSSLQEEAPAQLLQLPQEVEPSTQ
QEAPALPPESSMESLAQTPLNHEVTVQPPGEDQAHYNLPKFTVKPADVEVTMTSEPKNET
ESTQAQQEAPIQPPEEAEPSSTALRTTDPPPEHPEVTLPPSDKGQAQHSHLTEATVQPLD
LELSITTEPTTEVKPSPTTEETSAQPPDPGLAITPEPTTEIGHSTALEKTRAPHPDQVQT
LHRSLTEVTGPPTKLESSQDSLVQSETAPEEQKASTSTNICELCTCGDETLSCVGLSPKQ
RLRQVPVPEPDTYNGIFTTLNFQGNYISYLDGNVWKAYSWTEKLILSENYLTELPKDSFE
GLLYLQYLDLSCNKIRYIERQTFESLPFLQYINLGCNLITKLSLGTFQAWHGMQFLHNLI
LNRNPLTTVEDPYLFELPALKYLDMGTTHITLTTLKNILTMTVELEKLILPSHMACCLCQ
FKNSIEAVCKTVKLHCNTACLTNSIHCPEEASVGNPEGAFMKMLQARKQHMSTQLTIESE
APSDSSGINLSGFGGDQLEIQLTEQLRSLIPNEDVRKFMSHVIRTLKMECSETHVQGSCA
KLMLRTGLLMKLLSEQQEAKALNVEWDTDQQKTNYINENMEQNEQKEQKSSELMKEVPGD
DYKNKLIFAISVTVILIILIIIFCLIEVNSHKRASEKYKDNPSISGA
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggctgcgtttctggggcccatggcccctccttacgtggcaactattgtcttta
ctagtcaaggaggctcagcctctggtgtgggtcaaggacccgctccagctgacctctaac
cccctggggccacctgagccctggtcttcccgctcctcccatctcccatgggaatctccc
catgcacctgctcccccagcagccccgggggactttgattacctggggccctctgcttct
tcgcagatgtcagccctgcctcaggaaccaactgaaaatttggctccattcctgaaggaa
ttggattcagctggagagctgcccctggggccagagccgttcttggctgcacatcaggac
ttaaatgacaagcggactccagaagaaaggctcccagaggtggttccgcttctcaaccgg
gatcagaaccaggccctagttcagcttcctcgcctcaagtgggttcaaactacagatcta
gatcgggctgcaggtcatcaggcagatgaaatacttgttccactagacagtaaggtttca
agaccaaccaaatttgttgtttcgcccaagaacctgaagaaagatctagctgaacgttgg
agccttcctgagattgttgggattccacaccaattatccaaacctcagcgtcagaaacag
actttgccagatgattatttgagtatggacacactgtatcccggcagcctacctccagaa
ctccgggtgaacgcagatgagcctccagggcctcctgagcaagttggactttctcaattc
catctagagcccaaaagtcaaaatccagagacccttgaagacatccagtcctcttcactc
caggaagaagccccagcgcagcttctacagctccctcaggaggtagaaccttcaacccag
caggaggccccagctctgcctccagagtcctctatggagagtctagctcaaactccactg
aatcatgaagtgacagttcaacctccaggtgaggatcaagctcattataatttgcccaag
tttacagtcaaacctgcagatgtggaggttaccatgacttcagagcctaaaaatgagaca
gaatctacccaagcccagcaggaggccccaattcagcctcccgaggaggcggaaccttct
tctacagccctgaggactacagatcctcctccagaacaccctgaggtgacacttccacct
tcagacaagggtcaggctcagcattcacacctgactgaagccacagttcaacctctggac
ctggagcttagcataactacagagcctactacagaggttaaaccgtctccaaccacggag
gaaacctcagctcagcctccagacccggggcttgccataactccagaacccactacagag
attggacattccacagccctggagaagactagagctcctcatccagaccaggttcagact
ctgcatcgaagcctgactgaagtcacaggtccacctacaaagttagaatcttcgcaggat
tcattggtgcagtctgaaactgcaccagaggaacagaaggcctccacaagcaccaacata
tgtgagctctgcacctgcggagatgagactctgtcatgtgttggtctcagcccaaagcag
aggctccgccaagtgcctgtgccagagcccgacacctacaatggcatcttcaccacctta
aatttccaaggaaactatatttcataccttgatggaaatgtatggaaagcatacagttgg
accgagaaactaattctcagtgaaaattatttgactgaattacctaaggattcatttgaa
ggcctgctatacctccagtatttagatttatcctgcaataaaatacgatatattgaaaga
caaacatttgaatcactaccatttttgcagtatataaatctgggctgcaatttaattaca
aaactgagccttggaacatttcaggcctggcacggaatgcagtttttacacaacttaatt
ctcaatcgcaatcctctgactactgtcgaagatccatatctctttgaactgccggcatta
aaatatctagacatgggaacaacacacatcacacttacaacacttaagaacattctcacg
atgactgttgaactggaaaaactgatcttacctagccatatggcctgctgcctctgccaa
tttaaaaatagcattgaggctgtctgcaagacagtcaagctgcattgcaacactgcatgt
ctgactaacagcatacattgtcctgaagaagcatctgtagggaatccagaaggagcgttc
atgaagatgttacaagcccggaagcagcacatgagcactcagctgactattgagtcggag
gcgccctcagacagcagtggcatcaacttgtcaggctttgggggtgatcagcttgaaatt
cagctaaccgagcagctacggtccctcatccccaacgaggatgtgagaaagttcatgtct
catgttatccggaccttgaaaatggaatgttcagaaacacatgtgcaagggagctgtgcc
aagctcatgttgcgaacaggcctcctgatgaagcttctcagcgagcagcaggaagcaaag
gcattgaatgtagaatgggatacggaccaacaaaaaacaaattatattaatgagaacatg
gaacagaatgaacagaaagagcagaagtcaagtgagctcatgaaagaagttccaggagat
gactataagaacaaactcatcttcgcaatatctgtgactgtaatactaataattttgatt
ataattttttgtcttatagaggtgaattcacataaaagggcatcagaaaaatacaaagac
aacccatcaatatcaggagcctga

DBGET integrated database retrieval system