KEGG   Homo sapiens (human): 119Help
Entry
119               CDS       T01001                                 

Gene name
ADD2, ADDB
Definition
(RefSeq) adducin 2
  KO
K18622  adducin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    119 (ADD2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     119 (ADD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldolase_II Mac Occludin_ELL
Motif
Other DBs
NCBI-GeneID: 119
NCBI-ProteinID: NP_001171983
OMIM: 102681
HGNC: 244
Ensembl: ENSG00000075340
Vega: OTTHUMG00000129710
Pharos: P35612(Tbio)
UniProt: P35612 Q05DK5
Position
2p13.3
AA seq 726 aa AA seqDB search
MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQS
PSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHT
ADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEV
TASSLIKVNILGEVVEKGSSCFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMK
WGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGVVALGDTVE
EAFYKIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGSTFGPMQKSRL
GEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGAPVPALR
QHAQKQQKEKTRWLNTPNTYLRVNVADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIE
NPNQFVPLYTDPQEVLEMRNKIREQNRQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSK
GDEDTKDDSEETVPNPFSQLTDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPAS
PVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPETTQPEGVVVNGREEEQTAEE
ILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGSPSKSPSKKKKKFRTPSFLKKSKK
KEKVES
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagagacggtccccgaggctgcctcgccgccgcccccgcaggggcagccttac
tttgaccgcttctcagaggacgaccccgagtacatgcgccttcgcaaccgggcggcggac
ctgcggcaggacttcaacctgatggagcagaagaagcgcgtcaccatgatcctgcagagt
ccctctttcagggaggagctggaaggcctcatccaggagcagatgaagaaggggaacaac
tcctccaacatctgggccctgcgacagatcgcggacttcatggccagcacctcccacgca
gtcttcccgacatcttccatgaatgtctccatgatgacgcctatcaatgacctccacaca
gctgactccctgaacctggccaaaggggagcggctcatgcggtgcaagatcagcagtgtc
taccgactcctggacctctatggctgggcccagctgagtgacacctatgtcacgttgaga
gtcagcaaggagcaggaccacttcctgatcagccctaagggagtttcttgcagtgaagtc
acagcgtccagcctgatcaaggtgaacattctgggagaggtggtggagaagggcagcagc
tgcttcccagtggacaccacaggcttctgtctgcactcggccatctatgcagcgaggccc
gacgtgcgctgcatcatccacctgcacacaccggccacagcagcggtgtcggccatgaag
tggggcctcctgcctgtctcccacaatgccctgctggtgggggacatggcctattatgac
ttcaatggggaaatggagcaggaagccgatcggatcaacctgcagaagtgccttggaccc
acctgcaagatcctggtgctaagaaaccatggagtggttgctctgggtgacacggtagag
gaggcattttacaagatcttccacctgcaggctgcatgtgagatacaggtgtcggctctg
tccagtgccgggggagtggagaacctcatcctcctggagcaggagaagcaccggccccat
gaggtgggctccgtgcagtgggccgggagcacctttgggcctatgcagaagagtcggctg
ggggagcatgagtttgaggccctcatgaggatgctggacaacctgggctacagaacaggt
tacacgtatcgccacccctttgttcaagagaaaaccaaacacaaaagtgaggtggagatt
ccagccacggtcacagccttcgtgtttgaggaggacggtgccccggtgcccgccctgcga
cagcatgcccagaagcagcagaaggagaagacccgctggctcaatacgcccaacacctac
ctgcgggtcaatgtggccgatgaggtccagaggagcatgggcagcccccgacccaagacc
acgtggatgaaggctgacgaggtggagaaatccagcagtggcatgccgattcgcatcgaa
aacccaaaccaatttgtgcctctctatactgacccccaggaagtactggagatgaggaac
aagattcgagaacaaaaccgacaagatgtgaagtcagcggggcctcagtcccagctcctg
gcgagcgtcattgccgagaagagccgaagcccgtctacagagagccagctgatgtccaag
ggagacgaggataccaaagacgattcagaggagacggtgcccaaccccttcagccaactc
actgaccaggagttggaggagtacaagaaagaggtggagaggaagaaactagaacttgat
ggagagaaagaaactgccccagaagagcctggctcacctgcaaagtctgcacctgcttct
ccagtgcagagcccagcgaaggaggcagagacaaagagccctttagtctctccttccaag
tctttagaggaaggtactaagaagacagaaacaagcaaagccgccaccacagagcccgaa
acaacccagccggaaggggtggtggtcaacgggagggaggaggagcagacggcagaggaa
atcctcagcaaaggcctgagccagatgaccaccagtgctgacacggatgttgatacctct
aaggacaaaaccgagtcggtcaccagcggccccatgtccccagagggctcaccttccaag
tctccctcaaagaagaaaaagaaattccgaaccccctccttcctgaaaaagagcaaaaag
aaggagaaagtggagtcctga

DBGET integrated database retrieval system