KEGG   Homo sapiens (human): 124
Entry
124               CDS       T01001                                 

Gene name
ADH1A, ADH1
Definition
(RefSeq) alcohol dehydrogenase 1A (class I), alpha polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00620  Pyruvate metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Drug target
Fomepizole: D00707<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    124 (ADH1A)
   00620 Pyruvate metabolism
    124 (ADH1A)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    124 (ADH1A)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    124 (ADH1A)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    124 (ADH1A)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    124 (ADH1A)
   00982 Drug metabolism - cytochrome P450
    124 (ADH1A)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    124 (ADH1A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     124 (ADH1A)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 124
NCBI-ProteinID: NP_000658
OMIM: 103700
HGNC: 249
Ensembl: ENSG00000187758
Vega: OTTHUMG00000131026
Pharos: P07327(Tclin)
UniProt: P07327
Structure
PDB: 
1U3T 1HSO

Position
4q23
AA seq 375 aa
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNP
QGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTILMF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtggaggttgcacctcctaaggcccatgaagttcgtattaag
atggtggctgtaggaatctgtggcacagatgaccacgtggttagtggtaccatggtgacc
ccacttcctgtgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccactcgctattcctcagtgtggaaaa
tgcagaatttgtaaaaacccggagagcaactactgcttgaaaaacgatgtaagcaatcct
caggggaccctgcaggatggcaccagcaggttcacctgcaggaggaagcccatccaccac
ttccttggcatcagcaccttctcacagtacacagtggtggatgaaaatgcagtagccaaa
attgatgcagcctcgcctctagagaaagtctgtctcattggctgtggattttcaactggt
tatgggtctgcagtcaatgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctattatgggctgtaaagcagctggggcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccatccaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcatttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagtgtcatcgtaggggtacctcctgattcccaa
aacctctcaatgaaccctatgctgctactgactggacgtacctggaagggagctattctt
ggtggctttaaaagtaaagaatgtgtcccaaaacttgtggctgattttatggctaagaag
ttttcattggatgcattaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccattctgatgttttga

DBGET integrated database retrieval system