KEGG   Homo sapiens (human): 127602
Entry
127602            CDS       T01001                                 
Symbol
DNAH14, C1orf67, Dnahc14, HL-18, HL18
Name
(RefSeq) dynein axonemal heavy chain 14
  KO
K10408  dynein axonemal heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    127602 (DNAH14)
   05016 Huntington disease
    127602 (DNAH14)
   05022 Pathways of neurodegeneration - multiple diseases
    127602 (DNAH14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    127602 (DNAH14)
   04812 Cytoskeleton proteins [BR:hsa04812]
    127602 (DNAH14)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Dynein arm
   127602 (DNAH14)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     127602 (DNAH14)
SSDB
Other DBs
NCBI-GeneID: 127602
NCBI-ProteinID: NP_001138626
OMIM: 603341
HGNC: 2945
Ensembl: ENSG00000185842
Pharos: Q0VDD8(Tdark)
UniProt: Q0VDD8
Position
1:224929654..225399286
AA seq 453 aa
METFIPIDLTTENQEMDKEETKTKPRLLRYEEKKYEDVKPLETQPAEIAEKETLEYKTVR
TFSESLKSEKTEDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYD
RTEPKDDDVIRNIIRLREKLGWQTILPQHSLKYGSSKIAIQKITLKKPLEDDGEFVYCLP
RKSPKSLYNPYDLQVVSAHTAKHCKEFWVITASFISKVINIVGSVKEVELIPTLEWLSER
RHYYLLRQFKIFSDFRMNKAFVTWKLNVKRIKTEKSRSFLYHHLFLADDLFQTCLVYIRG
LCEDAINLKNYNDHENNLSAICLVKLDSSRTYSLDEFCEEQLQQATQALKQLEDIRNKAI
SEMKSTFLKVAEKNEIKEYFESKLSEDDTTHFKLPKYRRLLETFFKFVMLVDYIFQELIR
QLMNTAVTLLLELFNGSAGMPFSVEKKNENLIR
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggagacgtttatacccattgatttgacaactgaaaatcaagagatggacaaggaggaa
accaagacaaaaccaagacttttaagatatgaagagaaaaaatatgaagatgtgaaacca
ttagagactcaaccagctgaaatagcagaaaaggaaacattggaatataaaacagttaga
acattctctgaatctttgaagtcagagaaaacagaagattaccttagagaaagtataatt
caacaacatatggtttctccagagccagcttcccttaaggagaaagggaagtcaaggaga
aaaaaggatcaaactcatgcttgtccaaatgttaggaaagccaggcctgtgtcctatgat
agaacagaaccaaaagatgatgatgtgataagaaatattattaggctacgagaaaagctt
ggttggcaaactatattaccgcagcacagtttgaaatacggaagctccaaaattgcaatt
cagaagattactttaaagaaacctttggaagatgatggagaatttgtttattgccttcct
cggaaaagtcctaaatccctttacaatccatatgatcttcaggtagtatcggctcatact
gctaaacattgcaaagaattttgggttattactgcttcatttatctcaaaggttattaat
atagttggtagtgtaaaggaagtagaactcatacctactttggaatggctatcagaaaga
agacattactatttattacggcaattcaagatattttctgatttccgaatgaataaagca
tttgttacctggaaattgaatgttaaaagaattaagacagagaagagcaggtcatttttg
taccaccatctttttttggctgatgacttgtttcaaacctgtttggtttatataagagga
ctttgtgaagatgcaattaatctcaaaaattataatgaccatgaaaataatctatctgcc
atatgccttgtaaagctggatagttctcgaacatattctctagatgaattttgtgaagag
cagttacagcaagctacccaggcattgaaacaacttgaggacatcaggaataaagcaatt
tcagagatgaaaagtacttttctaaaggttgcagaaaagaatgaaatcaaagagtatttt
gagtcaaaactctctgaagatgacacaacacatttcaagctgcctaaatatagacgttta
ttagaaacatttttcaagtttgtaatgctggttgactacatatttcaggaactcattcgt
caacttatgaacactgcagtcacactacttttggaattatttaatggttctgctggaatg
ccattttcagtggaaaaaaagaatgaaaatcttatcaggtaa

DBGET integrated database retrieval system