KEGG   Homo sapiens (human): 1400Help
Entry
1400              CDS       T01001                                 

Gene name
CRMP1, CRMP-1, DPYSL1, DRP-1, DRP1, ULIP-3
Definition
(RefSeq) collapsin response mediator protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 1400
NCBI-ProteinID: NP_001304
OMIM: 602462
HGNC: 2365
Ensembl: ENSG00000072832
Vega: OTTHUMG00000125489
Pharos: Q14194(Tbio)
UniProt: Q14194 Q96I11
Structure
PDB: 

Position
4p16.2
AA seq 572 aa AA seqDB search
MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEA
NGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSF
EKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQ
LYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAI
TIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAA
FVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEE
RMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTI
TAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQ
RVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFS
LSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtaccagggcaagaagagcatcccgcacatcacgagtgaccgactcctcatcaaa
ggtggacggatcatcaacgatgaccaatccctttatgctgacgtctacctggaggatgga
cttatcaaacaaataggagagaacttaatcgttcctggtggagtgaagaccattgaagcc
aacgggcggatggttattcccggaggtattgatgtcaacacgtacctgcagaagccctcc
caggggatgactgcggctgatgacttcttccaagggaccagggcggcactggtgggcggg
accacgatgatcattgaccatgttgttcctgaacctgggtccagcctactgacctctttc
gagaagtggcacgaagcagctgacaccaaatcctgctgtgattactccctccacgtggac
atcacaagctggtacgatggcgttcgggaggagctggaggtgctggtgcaggacaaaggc
gtcaattccttccaagtctacatggcctataaggatgtctaccaaatgtccgacagccag
ctctatgaagcctttaccttccttaagggcctgggagctgtgatcttggtccatgcagaa
aatggagatttgatagctcaggaacaaaagcggatcctggagatgggcatcacgggtccc
gagggccatgccctgagcagacctgaagagctggaggccgaggcggtgttccgggccatc
accattgcgggccggatcaactgccctgtgtacatcaccaaggtcatgagcaagagtgca
gccgacatcatcgctctggccaggaagaaagggcccctagtttttggagagcccattgcc
gccagcctggggaccgatggcacccattactggagcaagaactgggccaaggctgcggcg
ttcgtgacttcccctcccctgagcccggaccctaccacgcccgactacttgacctcccta
ctggcctgtggggacttgcaggtcacaggcagcggccactgtccctacagcactgcccag
aaggcggtgggcaaggacaactttaccctgatccccgagggtgtcaacgggatagaggag
cggatgacggtcgtctgggacaaggcggtggctactggcaaaatggatgagaaccagttt
gtcgctgtcaccagcaccaatgcagccaagatctttaacctgtacccaaggaaagggcgg
attgccgtgggctcggatgccgacgtggtcatctgggaccccgacaagttgaagaccata
acagccaaaagtcacaagtcggcggtggagtacaacatcttcgagggtatggagtgccac
ggctccccactagtggtcatcagccagggcaagatcgtctttgaagacggaaacatcaac
gtcaacaagggcatgggccgcttcattccgcggaaggcgttcccggagcacctgtaccag
cgcgtcaaaatcaggaataaggtttttggattgcaaggggtttccaggggcatgtatgac
ggtcctgtgtacgaggtaccagctacacccaaatatgcaactcccgctccttcagccaaa
tcttcgccttctaaacaccagcccccacccatcagaaacctccaccagtccaacttcagc
ttatcaggtgcccagatagatgacaacaatcccaggcgcaccggccaccgcatcgtggcg
ccccctggtggccgctccaacatcaccagcctcggttga

DBGET integrated database retrieval system