KEGG   Homo sapiens (human): 146439Help
Entry
146439            CDS       T01001                                 

Gene name
BICDL2, BICDR-2, BICDR2, CCDC64B
Definition
(RefSeq) BICD family like cargo adaptor 2
  KO
K16756  coiled-coil domain-containing protein 64
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    146439 (BICDL2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    146439 (BICDL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAP1_N DUF641 bZIP_1
Motif
Other DBs
NCBI-GeneID: 146439
NCBI-ProteinID: NP_001096645
OMIM: 617003
HGNC: 33584
Ensembl: ENSG00000162069
Vega: OTTHUMG00000177452
Pharos: A1A5D9(Tdark)
UniProt: A1A5D9
Position
16p13.3
AA seq 508 aa AA seqDB search
MSSPDGPSFPSGPLSGGASPSGDEGFFPFVLERRDSFLGGGPGPEEPEDLALQLQQKEKD
LLLAAELGKMLLERNEELRRQLETLSAQHLEREERLQQENHELRRGLAARGAEWEARAVE
LEGDVEALRAQLGEQRSEQQDSGRERARALSELSEQNLRLSQQLAQASQTEQELQRELDA
LRGQCQAQALAGAELRTRLESLQGENQMLQSRRQDLEAQIRGLREEVEKGEGRLQTTHEE
LLLLRRERREHSLELERARSEAGEALSALRRLQRRVSELEEESRLQDADVSAASLQSELA
HSLDDGDQGQGADAPGDTPTTRSPKTRKASSPQPSPPEEILEPPKKRTSLSPAEILEEKE
VEVAKLQDEISLQQAELQSLREELQRQKELRAQEDPGEALHSALSDRDEAVNKALELSLQ
LNRVSLERDSLSRELLRAIRQKVALTQELEAWQDDMQVVIGQQLRSQRQKELSASASSST
PRRAAPRFSLRLGPGPAGGFLSNLFRRT
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccagatgggcccagcttcccgtccgggccgctctcagggggcgcctctccc
agcggcgacgagggcttcttcccctttgtgctggagcggcgggactcattcctgggaggg
ggcccagggcctgaggagcccgaggacctagccttgcagctgcagcagaaggagaaagac
ctgctgttggccgcggagctcggcaagatgcttctggagcgaaatgaagagctgcggcgg
cagctggagacgctgagcgcccagcacttggagcgtgaggaacggctccagcaggagaac
catgagctccggcgaggcctggcagcccgaggagccgagtgggaggcccgggccgtggag
ctggagggggacgtggaggccctgcgggcccagcttggggagcagcgctcagagcagcag
gacagtgggcgagaacgggcacgggccctcagcgagctcagcgagcagaacctccggctc
agccagcagctggctcaggcctcccagactgagcaggaacttcagagggaactggacgcc
cttcggggacagtgccaggctcaggcactggctggagcagagctgaggacgcggctggag
agtctgcagggggaaaaccagatgctgcagagccgccggcaggacctggaggcccagatc
cgaggcctgcgtgaggaggtggagaagggtgagggcagactgcagaccacccacgaggag
ttgctgctgctgaggcgggagcggcgggagcacagcctggagctggaacgcgcacggtca
gaggctggggaggcgctgagtgcgctgcggaggctgcagcggcgcgtctccgagctggag
gaggagtcacgcctccaggacgccgacgtgtcggctgcctcgttgcagtcagaactggcc
cacagcctcgacgacggcgaccagggccagggcgccgacgcacccggagacaccccgacc
acccggtccccaaagacccgaaaggcgtccagcccccagccttcacccccggaagagatc
ttagagccccccaagaagcgaacatccctcagtccagcggagatactggaggagaaggag
gtggaagtggccaagctgcaagatgagatctcgctgcagcaggcagagctgcagtccctg
cgggaagagctgcagaggcagaaggagctgcgggcgcaggaagaccctggggaggccctg
cacagtgccctctcagaccgggacgaggccgtgaacaaggccctggagctgtccctgcag
ctcaaccgcgtctcgctggagcgagactccctgtctcgggagctgctgcgcgccatccgc
cagaaggtggcgctcacgcaggagctggaggcctggcaggacgacatgcaggtggtgatc
gggcagcagctgcgctcacagcgccagaaggagctgagcgcctccgcgtcgtcgtcgacc
ccgcgccgtgccgcgccccgcttctcgctgcgcctgggccccgggcccgccggtggcttt
ctcagtaacctcttccgaaggacctga

DBGET integrated database retrieval system