KEGG   Homo sapiens (human): 163859
Entry
163859            CDS       T01001                                 
Symbol
SDE2, C1orf55, dJ671D7.1
Name
(RefSeq) SDE2 telomere maintenance homolog
  KO
K25059  replication stress response regulator SDE2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    163859 (SDE2)
   03032 DNA replication proteins [BR:hsa03032]
    163859 (SDE2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    163859 (SDE2)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    163859 (SDE2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    163859 (SDE2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    163859 (SDE2)
SSDB
Motif
Pfam: SDE2_2C Sde2_N_Ubi RNA_lig_T4_1 Exonuc_VII_L
Other DBs
NCBI-GeneID: 163859
NCBI-ProteinID: NP_689821
HGNC: 26643
Ensembl: ENSG00000143751
Pharos: Q6IQ49(Tbio)
UniProt: Q6IQ49
Structure
Position
1:complement(225982702..225999343)
AA seq 451 aa
MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSD
TVQHGAVYSLEPRLCGGKGGFGSMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAE
WVKQQAEREAEKEQKRLERLQRKLVEPKHCFTSPDYQQQCHEMAERLEDSVLKGMQAASS
KMVSAEISENRKRQWPTKSQTDRGASAGKRRCFWLGMEGLETAEGSNSESSDDDSEEAPS
TSGMGFHAPKIGSNGVEMAAKFPSGSQRARVVNTDHGSPEQLQIPVTDSGRHILEDSCAE
LGESKEHMESRMVTETEETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAEVAPE
ERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQ
ERAARLFSVRGLAKEQIDPALFAKPLKGKKK
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggcggaggccgcggcgctggtgtggattcgcggccctggcttcgggtgcaaggcggtg
cggtgtgcctcgggtcggtgcaccgtccgggattttatccaccggcactgccaagatcag
aatgttccagtggaaaacttctttgtgaaatgcaatggagcactcattaacaccagtgac
acagtgcagcatggagctgtttatagtttggaacccagactttgcggtggaaaaggaggt
tttggatctatgctccgagcacttggtgctcagattgagaagacaaccaatcgagaagct
tgtcgggatctcagtggaaggagactacgcgatgtcaatcatgaaaaagcaatggctgaa
tgggtaaaacaacaagccgagcgagaggctgaaaaggagcagaagcggctggagcgactg
cagcggaagcttgtagaacccaagcactgcttcaccagccccgactaccagcagcagtgc
catgagatggctgagcgtctggaggattccgtcctcaaaggtatgcaggctgcctccagc
aagatggtttcagcagaaatcagtgagaatcggaaacggcaatggcctactaaatctcaa
acagacagaggagccagtgcgggaaagaggagatgcttctggttgggcatggagggacta
gagactgcagaagggtccaactctgagagttcagatgatgacagtgaagaagcaccaagc
acttcaggaatgggtttccatgctccaaaaattggtagcaatggtgtcgagatggcagcc
aaatttcccagtggttctcagagggcgagagtagtgaatacagaccatggatcaccagaa
caactgcagatcccggtgactgactctgggaggcatattttagaagactcatgtgctgag
ctgggggagtccaaagagcacatggaaagcaggatggttacagaaacagaagagacccag
gagaagaaggcagagagtaaagaacccatagaagaggagcccactggggctggactgaat
aaggataaagagacagaagaaaggactgatggggaaagagttgctgaggtagcacctgaa
gaaagggaaaacgttgccgttgccaaactgcaggaaagccagccaggaaacgcagttatt
gataaggaaactatagatttattggcgttcacctctgttgcagaactggagttgctgggt
ttggagaagctcaaatgtgaactgatggcccttggactgaaatgtgggggcactctgcag
gagcgggcagcaagactcttctctgtcagaggactggcaaaggagcaaattgacccggct
ttatttgccaagcctttgaaagggaagaaaaaatga

DBGET integrated database retrieval system