KEGG   Homo sapiens (human): 165530Help
Entry
165530            CDS       T01001                                 

Gene name
CLEC4F, CLECSF13, KCLR
Definition
(RefSeq) C-type lectin domain family 4 member F
  KO
K10060  C-type lectin domain family 4 member F
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    165530 (CLEC4F)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Largerin and kupffer cell receptors
    165530 (CLEC4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C HMMR_N Spc7 WEMBL Phage_GP20 RPW8 CENP-F_leu_zip Fez1 DASH_Duo1 GAS DUF2353 Tropomyosin_1 Golgin_A5 Csm1_N DUF4201 DUF2730 TPR_MLP1_2 Laminin_II DUF1579 DHR10 Fib_alpha MAD MscS_porin DUF812 AIP3
Motif
Other DBs
NCBI-GeneID: 165530
NCBI-ProteinID: NP_775806
HGNC: 25357
Ensembl: ENSG00000152672
Vega: OTTHUMG00000129713
Pharos: Q8N1N0(Tdark)
UniProt: Q8N1N0
Position
2p13.3
AA seq 589 aa AA seqDB search
MDGEAVRFCTDNQCVSLHPQEVDSVAMAPAAPKIPRLVQATPAFMAVTLVFSLVTLFVVV
QQQTRPVPKPVQAVILGDNITGHLPFEPNNHHHFGREAEMRELIQTFKGHMENSSAWVVE
IQMLKCRVDNVNSQLQVLGDHLGNTNADIQMVKGVLKDATTLSLQTQMLRSSLEGTNAEI
QRLKEDLEKADALTFQTLNFLKSSLENTSIELHVLSRGLENANSEIQMLNASLETANTQA
QLANSSLKNANAEIYVLRGHLDSVNDLRTQNQVLRNSLEGANAEIQGLKENLQNTNALNS
QTQAFIKSSFDNTSAEIQFLRGHLERAGDEIHVLKRDLKMVTAQTQKANGRLDQTDTQIQ
VFKSEMENVNTLNAQIQVLNGHMKNASREIQTLKQGMKNASALTSQTQMLDSNLQKASAE
IQRLRGDLENTKALTMEIQQEQSRLKTLHVVITSQEQLQRTQSQLLQMVLQGWKFNGGSL
YYFSSVKKSWHEAEQFCVSQGAHLASVASKEEQAFLVEFTSKVYYWIGLTDRGTEGSWRW
TDGTPFNAAQNKAPGSKGSCPLRKYIIVNSGMGACSFIDTPPCPWILSN
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggacggtgaggcagtccgcttctgcacagataaccagtgtgtctccctgcacccccaa
gaggtggactctgtggcaatggctcctgcagcccccaagataccgaggctcgttcaggct
accccggcatttatggctgtgaccttggtcttctctcttgtgactctctttgtagtggtt
caacagcagacaagacctgttccgaagcctgtgcaagccgtaattctgggagacaacatt
actgggcatttaccttttgaacccaacaatcatcaccactttggcagggaggcagaaatg
cgagagcttatccagacatttaaaggccacatggagaattccagtgcctgggtagtagaa
atccagatgttgaagtgcagagtggacaatgtcaattcgcagctccaggtgctcggtgat
catctgggaaacaccaatgctgacatccagatggtaaaaggagttctaaaggatgccact
acattgagtttgcagacacagatgttaaggagttccctggagggaaccaatgctgagatc
cagaggctcaaggaagaccttgaaaaggcagatgctttaactttccagacgctgaatttc
ttaaaaagcagtttagaaaacaccagcattgagctccacgtgctaagcagaggcttagaa
aatgcaaactctgaaattcagatgttgaatgccagtttggaaacggcaaatacccaggct
cagttagccaatagcagtttaaagaacgctaatgctgagatctatgttttgagaggccat
ctagatagtgtcaatgacttgaggacccagaaccaggttttaagaaatagtttggaagga
gccaatgctgagatccagggactaaaggaaaatttgcagaacacaaatgctttaaactcc
cagacccaggcctttataaaaagcagttttgacaacactagtgctgagatccagttctta
agaggtcatttggaaagagctggtgatgaaattcacgtgttaaaaagggatttgaaaatg
gtcacagcccagacccaaaaagcaaatggccgtctggaccagacagatactcagattcag
gtattcaagtcagagatggaaaatgtgaataccttaaatgcccagattcaggtcttaaat
ggtcatatgaaaaatgccagcagagagatacagaccctaaaacaaggaatgaagaatgct
tcagccttaacttcccagacccagatgttagacagcaatctgcagaaggccagtgccgag
atccagaggttaagaggggatctagagaacaccaaagctctaaccatggaaatccagcag
gagcagagtcgcctgaagaccctccatgtggtcattacttcacaggaacagctacaaaga
acccaaagtcagcttctccagatggtcctgcaaggctggaagttcaatggtggaagctta
tattatttttctagtgtcaagaagtcttggcatgaggctgagcagttctgcgtgtcccag
ggagcccatctggcatctgtggcctccaaggaggagcaggcatttctggtagagttcaca
agtaaagtgtactactggatcggtctcactgacaggggcacagagggctcctggcgctgg
acagatgggacaccattcaacgccgcccagaacaaagcgcctggttccaagggatcctgc
ccactcagaaagtatattattgtgaattctgggatgggagcttgcagcttcatagacacc
cctccctgtccctggatcctcagtaactaa

DBGET integrated database retrieval system