KEGG   Homo sapiens (human): 1745Help
Entry
1745              CDS       T01001                                 

Gene name
DLX1
Definition
(RefSeq) distal-less homeobox 1
  KO
K09314  homeobox protein DLX1/4/6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1745 (DLX1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Dll
    1745 (DLX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN Homez YdaS_antitoxin
Motif
Other DBs
NCBI-GeneID: 1745
NCBI-ProteinID: NP_835221
OMIM: 600029
HGNC: 2914
Ensembl: ENSG00000144355
Vega: OTTHUMG00000073951
Pharos: P56177(Tbio)
UniProt: P56177 X5D2F9
Position
2q31.1
AA seq 255 aa AA seqDB search
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSA
SSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVR
FNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR
SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSW
YPSAHQEAMQQPQLM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaccaccatgccagaaagtctcaacagccccgtgtcgggcaaggcggtgttt
atggagtttgggccgcccaaccagcaaatgtctccttctcccatgtcccacgggcactac
tccatgcactgtttacactcggcgggccattcgcagcccgacggcgcctacagctcagcc
tcgtccttctcccgaccgctgggctacccctacgtcaactcggtcagcagccacgcatcc
agcccctacatcagttcggtgcagtcctacccgggcagcgccagcctcgcccagagccgc
ctggaggacccaggggcggactcggagaagagcacggtggtggaaggcggtgaagtgcgc
ttcaatggcaagggaaaaaagatccgtaaacccaggacgatttattccagtttgcagttg
caggctttgaaccggaggttccagcaaactcagtacctagctctgccggagagggcggag
ctcgcggcctctttgggactcacacagactcaggtcaagatctggttccaaaacaagcga
tccaagttcaagaagctgatgaagcagggtggggcggctctggagggtagtgcgttggcc
aacggtcgggccctgtctgctggctccccacccgtgccgcccggctggaaccctaactct
tcatccgggaagggctcaggaggaaacgcgggctcctatatccccagctacacatcgtgg
tacccttcagcgcaccaagaagctatgcagcaaccccaacttatgtga

DBGET integrated database retrieval system