KEGG   Homo sapiens (human): 2023
Entry
2023              CDS       T01001                                 

Gene name
ENO1, ENO1L1, HEL-S-17, MPB1, NNE, PPH
Definition
(RefSeq) enolase 1
  KO
K01689  enolase [EC:4.2.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa03018  RNA degradation
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2023 (ENO1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    2023 (ENO1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    2023 (ENO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    2023 (ENO1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2023 (ENO1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     2023 (ENO1)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     2023 (ENO1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2023 (ENO1)
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 2023
NCBI-ProteinID: NP_001419
OMIM: 172430
HGNC: 3350
Ensembl: ENSG00000074800
Vega: OTTHUMG00000001773
Pharos: P06733(Tchem)
UniProt: P06733 A0A024R4F1
Structure
PDB: 
3B97 2PSN

Position
1p36.23
AA seq 434 aa
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGK
GVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCK
AGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFRE
AMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKV
VIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLA
QANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
AKFAGRNFRNPLAK
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtctattctcaagatccatgccagggagatctttgactctcgcgggaatcccactgtt
gaggttgatctcttcacctcaaaaggtctcttcagagctgctgtgcccagtggtgcttca
actggtatctatgaggccctagagctccgggacaatgataagactcgctatatggggaag
ggtgtctcaaaggctgttgagcacatcaataaaactattgcgcctgccctggttagcaag
aaactgaacgtcacagaacaagagaagattgacaaactgatgatcgagatggatggaaca
gaaaataaatctaagtttggtgcgaacgccattctgggggtgtcccttgccgtctgcaaa
gctggtgccgttgagaagggggtccccctgtaccgccacatcgctgacttggctggcaac
tctgaagtcatcctgccagtcccggcgttcaatgtcatcaatggcggttctcatgctggc
aacaagctggccatgcaggagttcatgatcctcccagtcggtgcagcaaacttcagggaa
gccatgcgcattggagcagaggtttaccacaacctgaagaatgtcatcaaggagaaatat
gggaaagatgccaccaatgtgggggatgaaggcgggtttgctcccaacatcctggagaat
aaagaaggcctggagctgctgaagactgctattgggaaagctggctacactgataaggtg
gtcatcggcatggacgtagcggcctccgagttcttcaggtctgggaagtatgacctggac
ttcaagtctcccgatgaccccagcaggtacatctcgcctgaccagctggctgacctgtac
aagtccttcatcaaggactacccagtggtgtctatcgaagatccctttgaccaggatgac
tggggagcttggcagaagttcacagccagtgcaggaatccaggtagtgggggatgatctc
acagtgaccaacccaaagaggatcgccaaggccgtgaacgagaagtcctgcaactgcctc
ctgctcaaagtcaaccagattggctccgtgaccgagtctcttcaggcgtgcaagctggcc
caggccaatggttggggcgtcatggtgtctcatcgttcgggggagactgaagataccttc
atcgctgacctggttgtggggctgtgcactgggcagatcaagactggtgccccttgccga
tctgagcgcttggccaagtacaaccagctcctcagaattgaagaggagctgggcagcaag
gctaagtttgccggcaggaacttcagaaaccccttggccaagtaa

DBGET integrated database retrieval system