KEGG   Homo sapiens (human): 216
Entry
216               CDS       T01001                                 
Symbol
ALDH1A1, ALDC, ALDH-E1, ALDH1, ALDH11, HEL-9, HEL-S-53e, HEL12, PUMB1, RALDH1
Name
(RefSeq) aldehyde dehydrogenase 1 family member A1
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    216 (ALDH1A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     216 (ALDH1A1)
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 216
NCBI-ProteinID: NP_000680
OMIM: 100640
HGNC: 402
Ensembl: ENSG00000165092
Pharos: P00352(Tchem)
CPD: C22546
UniProt: P00352 V9HW83
Structure
Position
9:complement(72900671..72953053)
AA seq 501 aa
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgtcatcctcaggcacgccagacttacctgtcctactcaccgatttgaagattcaatat
actaagatcttcataaacaatgaatggcatgattcagtgagtggcaagaaatttcctgtc
tttaatcctgcaactgaggaggagctctgccaggtagaagaaggagataaggaggatgtt
gacaaggcagtgaaggccgcaagacaggcttttcagattggatccccgtggcgtactatg
gatgcttccgagagggggcgactattatacaagttggctgatttaatcgaaagagatcgt
ctgctgctggcgacaatggagtcaatgaatggtggaaaactctattccaatgcatatctg
aatgatttagcaggctgcatcaaaacattgcgctactgtgcaggttgggctgacaagatc
cagggccgtacaataccaattgatggaaatttttttacatatacaagacatgaacctatt
ggtgtatgtggccaaatcattccttggaatttcccgttggttatgctcatttggaagata
gggcctgcactgagctgtggaaacacagtggttgtcaaaccagcagagcaaactcctctc
actgctctccacgtggcatctttaataaaagaggcagggtttcctcctggagtagtgaat
attgttcctggttatgggcctacagcaggggcagccatttcttctcacatggatatagac
aaagtagccttcacaggatcaacagaggttggcaagttgatcaaagaagctgccgggaaa
agcaatctgaagagggtgaccctggagcttggaggaaagagcccttgcattgtgttagct
gatgccgacttggacaatgctgttgaatttgcacaccatggggtattctaccaccagggc
cagtgttgtatagccgcatccaggatttttgtggaagaatcaatttatgatgagtttgtt
cgaaggagtgttgagcgggctaagaagtatatccttggaaatcctctgaccccaggagtc
actcaaggccctcagattgacaaggaacaatatgataaaatacttgacctcattgagagt
gggaagaaagaaggggccaaactggaatgtggaggaggcccgtgggggaataaaggctac
tttgtccagcccacagtgttctctaatgttacagatgagatgcgcattgccaaagaggag
atttttggaccagtgcagcaaatcatgaagtttaaatctttagatgacgtgatcaaaaga
gcaaacaatactttctatggcttatcagcaggagtgtttaccaaagacattgataaagcc
ataacaatctcctctgctctgcaggcaggaacagtgtgggtgaattgctatggcgtggta
agtgcccagtgcccctttggtggattcaagatgtctggaaatggaagagaactgggagag
tacggtttccatgaatatacagaggtcaaaacagtcacagtgaaaatctctcagaagaac
tcataa

DBGET integrated database retrieval system