KEGG   Homo sapiens (human): 23190Help
Entry
23190             CDS       T01001                                 

Gene name
UBXN4, UBXD2, UBXDC1, erasin
Definition
(RefSeq) UBX domain protein 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: UBX
Motif
Other DBs
NCBI-GeneID: 23190
NCBI-ProteinID: NP_055422
OMIM: 611216
HGNC: 14860
Ensembl: ENSG00000144224
Vega: OTTHUMG00000153577
Pharos: Q92575(Tdark)
UniProt: Q92575
Structure
PDB: 

Position
2q21.3
AA seq 508 aa AA seqDB search
MLWFQGAIPAAIATAKRSGAVFVVFVAGDDEQSTQMAASWEDDKVTEASSNSFVAIKIDT
KSEACLQFSQIYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVRQMHLLKSETS
VANGSQSESSVSTPSASFEPNNTCENSQSRNAELCEIPPTSDTKSDTATGGESAGHATSS
QEPSGCSDQRPAEDLNIRVERLTKKLEERREEKRKEEEQREIKKEIERRKTGKEMLDYKR
KQEEELTKRMLEERNREKAEDRAARERIKQQIALDRAERAARFAKTKEEVEAAKAAALLA
KQAEMEVKRESYARERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNF
SLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIVHSSSGDIWTLLGTVLY
PFLAIWRLISNFLFSNPPPTQTSVRVTSSEPPNPASSSKSEKREPVRKRVLEKRGDDFKK
EGKIYRLRTQDDGEDENNTWNGNSTQQM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggttccagggcgccattccggccgccatcgcgacggccaaaaggagcggcgcg
gtcttcgtggtgttcgtggcaggtgatgatgaacagtctacacagatggctgcaagttgg
gaagatgataaagttacagaagcatcttcaaacagttttgttgctattaaaatcgatacc
aaaagtgaagcctgcctacagttttcacaaatctatcctgtagtgtgtgttccatccagt
ttctttattggagacagtggaattcccttggaagtaatagcaggaagtgtttctgcagat
gaacttgttacaagaattcacaaggtccgacagatgcatttgctaaaaagtgaaacatca
gtagcaaatggcagtcagtcagaaagttcagtgtctactccatctgcgtcatttgaacct
aacaacacttgtgaaaactctcagtccagaaatgcagagctttgtgagataccacccact
tctgatacaaagtcagatactgcaacaggaggagaaagtgcaggccatgccacttcctct
caggagcctagtggatgctcagatcagagacctgcagaggacctcaacatccgagtggaa
agactaacaaaaaaacttgaagaaaggagagaagagaaaagaaaagaggaagaacagaga
gaaattaagaaggaaattgagaggagaaaaactggaaaagaaatgttggattataaaaga
aaacaagaagaagaattaacaaaaagaatgctggaggaaagaaacagagagaaagcagaa
gatagggcagctcgagaacgtataaaacagcagattgcattggaccgtgcagagagagct
gctcgttttgcaaagacaaaggaagaagtagaggctgccaaagctgctgccttgctagca
aaacaggcagaaatggaagtcaagagggaatcttatgcaagagaaagaagcactgttgca
agaattcaattccgtcttcctgatggttcttcctttacaaatcagttcccttctgatgct
cctctagaagaggcaaggcagtttgctgcacagactgttggcaacacttacggtaatttt
tcgttagcaaccatgtttcccaggagggaatttaccaaagaagattataaaaagaagtta
ctggatttggaacttgccccaagcgcttcggtggtactgttgccagcaggaagaccaact
gcatccattgtacactcttccagcggagacatttggaccttgttgggaacagtgctttat
ccattccttgccatctggagattaattagcaatttcttgtttagtaatccgcctcccaca
cagacttcagtgagagtaacatcgtcagaacccccaaaccctgcatcatctagcaaatca
gaaaaaagggaaccagtgagaaaaagagtgctggaaaaacgtggagacgactttaaaaag
gaggggaaaatttatagattaaggactcaagatgatggtgaagatgaaaacaacacttgg
aatggaaattccactcaacagatgtag

DBGET integrated database retrieval system