KEGG   Homo sapiens (human): 23263
Entry
23263             CDS       T01001                                 
Symbol
MCF2L, ARHGEF14, DBS, OST
Name
(RefSeq) MCF.2 cell line derived transforming sequence like
  KO
K20685  guanine nucleotide exchange factor MCF2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23263 (MCF2L)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    23263 (MCF2L)
SSDB
Motif
Pfam: RhoGEF CRAL_TRIO_2 Spectrin PH SH3_2 SH3_1 SH3_9 PH_10
Other DBs
NCBI-GeneID: 23263
NCBI-ProteinID: NP_001307745
OMIM: 609499
HGNC: 14576
Ensembl: ENSG00000126217
Pharos: O15068(Tbio)
UniProt: O15068
Position
13:112894335..113099742
AA seq 1129 aa
MAEKGASRGTLRRLWSLPRRRRGTAGRSRPDEIMHQDIVPLCAADIQDQLKKRFAYLSGG
RGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRRDKWTSVK
ASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDDFKMKVPVIMLSSVPDLHGY
IDKSQLTEDLGGTLDYCHSRWLCQRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQS
TSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLL
AQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFREVKAILDAASQKIATFTDIGNSLAH
VEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHLCDQFSAE
IARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETG
AENKIQELNAIYKEYESILNQDLMEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQ
PVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRGSAGEEEE
SLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNME
EIYHFHNRIFLRELENYTDCPELVGRCFLERMEDFQIYEKYCQNKPRSESLWRQCSDCPF
FQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALSSILGILK
AVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHE
KAVLFCKKREENGEGYEKAPSYSYKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQ
APTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRGNSRNIKK
LEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEE
DGGLGPKKLVPGKYTVVADHEKGGPDALRVRSGDVVELVQEGDEGLWYVRDPTTGKEGWV
PASSLSVRLGPSGSAQCLSSSESSPGSAVLSNSSSCSEGGQAPFSDLQG
NT seq 3390 nt   +upstreamnt  +downstreamnt
atggccgagaagggagcatcccggggaaccctgcggcggctgtggtcactgcccaggagg
cgccggggaactgcagggcgctcgaggccagatgaaatcatgcaccaggacatcgtcccg
ctctgtgctgccgacatccaggaccagctaaagaagcgctttgcttacctgtccggtggg
cgggggcaggacggaagcccggttatcaccttccctgactacccggccttcagcgagatt
ccggacaaggagttccagaatgtcatgacctacctcaccagcatccccagcctgcaggac
gctggcatcggattcatcctggtgatagaccggcgacgggacaaatggacctccgtgaag
gcgtccgtcctgcgcatcgcagcatctttcccggcaaacctgcagctcgtcctcgtgctt
cgcccgacgggttttttccaaaggactctctccgacatcgctttcaaattcaatagagat
gactttaagatgaaggtgccggtcataatgctgagctccgtaccagacttacacggttac
atcgataagtcgcagctgaccgaggacctgggtgggaccctggactactgccactcccgg
tggctgtgccagcgcacggccatcgaaagtttcgccctcatggtgaagcagacggctcag
atgctgcagtccttcgggaccgagctggctgaaacagagctgcccaatgacgtccagtcg
acaagctcagtgctgtgtgcgcacacagagaagaaggacaaggcgaaggaggatttgagg
ctggcactgaaagaggggcacagtgtcctggagagcctcagggagctgcaggctgagggc
tcagagcccagtgtgaaccaggaccagcttgacaaccaggccaccgtgcagaggctcctg
gcccagctgaacgaaaccgaggctgccttcgatgagttctgggcaaagcatcagcagaaa
ctggagcagtgtctgcagctccggcactttgagcagggcttccgggaggtcaaagccatc
ttggacgcagcgtcccagaagatagcaaccttcacagacatcggcaacagcctggcgcat
gtggagcacctgctgagggacctggccagcttcgaggagaaatcaggcgtggccgtggag
agggcccgggccctgtctctggacggcgagcagctcattgggaacaagcactacgcggta
gactccatccgcccaaagtgccaggagctccggcacctctgtgaccagttctctgcggag
atcgcaaggaggagggggctgctcagcaagtccctggagctgcaccgccgcctggagacg
tccatgaagtggtgtgatgaagggatttacctgctggcctcacaacctgtggacaagtgc
cagtcccaggacggcgcggaggctgccctccaggaaatcgagaagtttttggagaccggt
gcggaaaataagatccaggagctcaacgcgatttacaaggaatacgaatccatcctcaac
caagatctcatggagcacgtgcgaaaggtcttccagaagcaggcaagcatggaggaggtg
ttccaccgcaggcaggccagcctgaagaagctggcggccaggcagacgcggcccgtgcag
ccggtggcccccagacccgaggcactggcaaagtcgccctgcccctccccaggcattcgg
cgaggctctgagaactccagctccgagggcggtgcgctccggagagggccctaccggagg
gccaagagtgagatgagtgagagccggcagggccgcggctcagcgggggaggaggaggaa
agcctggccatcctgcgcaggcacgtgatgagcgagctcctggacacagaacgggcctac
gtggaggagctgctgtgcgtcctggagggctacgccgcggagatggataacccactgatg
gctcacctcctgtcaacaggccttcacaacaagaaggatgttttgtttggaaacatggag
gaaatctatcacttccacaacaggatattcctcagggagctggaaaactacactgactgc
ccagaactggttggaagatgctttctggagaggatggaagatttccagatctatgagaag
tactgtcagaacaagccccgctctgagagcctgtggagacagtgctccgactgcccgttt
ttccaggaatgccagagaaagctggaccacaagctgagcctggactcctacctgctgaag
ccagtgcagaggatcaccaagtaccagctgctgctcaaggaaatgctgaaatacagcagg
aactgcgagggggctgaggacctgcaggaggcgctgagctccatcctgggcatcctgaag
gccgtgaacgactccatgcacctcatcgctatcaccggctatgacgggaatctcggcgac
ctgggcaagctgctgatgcagggctcgttcagcgtctggaccgaccacaagaggggccac
accaaggtgaaggagctggccaggttcaagcccatgcagcggcacctgttcctgcacgag
aaggcagtgctcttctgcaagaagagggaggagaatggggaggggtatgagaaagctccc
tcctacagctacaagcagtccttaaacatggctgccgttggcattacggagaacgtgaag
ggagatgctaagaagttcgagatctggtacaacgcgcgcgaggaggtctacatcgtccag
gcgccaactcctgagattaaagccgcgtgggtgaatgaaattcggaaagtgctgaccagc
cagctgcaggcttgtagagaagccagccagcaccgggcgctggagcagtcacagagcctg
cccctgccggccccgaccagcaccagtccctcaagaggaaactcaaggaacatcaagaag
ctggaagaaaggaaaacagaccccctaagcctggagggatacgtcagctcagcgccactg
acaaagccccccgaaaagggcaaaggttggagcaaaacgtcccactcactggaggcacct
gaggacgacgggggctggtcaagtgcagaggagcagattaactcgtccgacgcagaggag
gacggcgggttgggccccaagaagctggttccaggtaaatacacggtcgtggcggaccac
gagaagggaggccccgatgcgctgcgcgtgaggagcggggacgtggtggagctggtgcag
gagggcgacgagggcctctggtacgtcagggacccgaccactggcaaggagggctgggtg
ccggccagcagcctgtccgtccggctcggcccgtccggctcggcccagtgcctgagcagc
tcagagtcgagcccggggtcggccgtgctgagcaactcgtccagctgcagcgagggcggc
caggcccccttctccgacctgcaggggtag

DBGET integrated database retrieval system