KEGG   Homo sapiens (human): 23512Help
Entry
23512             CDS       T01001                                 

Gene name
SUZ12, CHET9, JJAZ1
Definition
(RefSeq) SUZ12 polycomb repressive complex 2 subunit
  KO
K11463  polycomb protein SUZ12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23512 (SUZ12)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH1 complex
     23512 (SUZ12)
    PRC2-EZH2 complex
     23512 (SUZ12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEFS-Box DUF2070
Motif
Other DBs
NCBI-GeneID: 23512
NCBI-ProteinID: NP_056170
OMIM: 606245
HGNC: 17101
Ensembl: ENSG00000178691
Vega: OTTHUMG00000132813
Pharos: Q15022(Tbio)
UniProt: Q15022
Structure
PDB: 

Position
17q11.2
AA seq 739 aa AA seqDB search
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSA
AAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSH
RNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPS
NSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMT
VFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPN
ENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVY
HPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQI
EEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHL
VSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEK
ALETDSVSGVSKQSKKQKL
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcagaagcacggcggtgggggagggggcggctcggggcccagcgcggggtcc
gggggaggcggcttcgggggttcggcggcggtggcggcggcgacggcttcgggcggcaaa
tccggcggcgggagctgtggagggggtggcagttactcggcctcctcctcctcctccgcg
gcggcagcggcgggggctgcggtgttaccggtgaagaagccgaaaatggagcacgtccag
gctgaccacgagcttttcctccaggcctttgagaagccaacacagatctatagatttctt
cgaactcggaatctcatagcaccaatatttttgcacagaactcttacttacatgtctcat
cgaaactccagaacaaacatcaaaaggaaaacatttaaagttgatgatatgttatcaaaa
gtagagaaaatgaaaggagagcaagaatctcatagcttgtcagctcatttgcagcttacg
tttactggtttcttccacaaaaatgataagccatcaccaaactcagaaaatgaacaaaat
tctgttaccctggaagtcctgcttgtgaaagtttgccacaaaaaaagaaaggatgtaagt
tgtccaataaggcaagttcccacaggtaaaaagcaggtgcctttgaatcctgacctcaat
caaacaaaacccggaaatttcccgtcccttgcagtttccagtaatgaatttgaacctagt
aacagccatatggtgaagtcttactcgttgctatttagagtgactcgtccaggaagaaga
gagtttaatggaatgattaatggagaaaccaatgaaaatattgatgtcaatgaagagctt
ccagccagaagaaaacgaaatcgtgaggatggggaaaagacatttgttgcacaaatgaca
gtatttgataaaaacaggcgcttacagcttttagatggggaatatgaagtagccatgcag
gaaatggaagaatgtccaataagcaagaaaagagcaacatgggagactattcttgatggg
aagaggctgcctccattcgaaacattttctcagggacctacgttgcagttcactcttcgt
tggacaggagagaccaatgataaatctacggctcctattgccaaacctcttgccactaga
aattcagagagtctccatcaggaaaacaagcctggttcagttaaacctactcaaactatt
gctgttaaagaatcattgactacagatctacaaacaagaaaagaaaaggatactccaaat
gaaaaccgacaaaaattaagaatattttatcagtttctctataacaacaatacaaggcaa
caaactgaagcaagagatgacctgcattgcccttggtgtactctgaactgccgcaaactt
tatagtttactcaagcatcttaaactctgccatagcagatttatcttcaactatgtttat
catccaaaaggtgctaggatagatgtttctatcaatgagtgttatgatggctcctatgca
ggaaatcctcaggatattcatcgccaacctggatttgcttttagtcgcaacggaccagtt
aagagaacacctatcacacatattcttgtgtgcaggccaaaacgaacaaaagcaagcatg
tctgaatttcttgaatctgaagatggggaagtagaacagcaaagaacatatagtagtggc
cacaatcgtctgtatttccatagtgatacctgcttacctctccgtccacaagaaatggaa
gtagatagtgaagatgaaaaggatcctgaatggctaagagaaaaaaccattacacaaatt
gaagagttttctgatgttaatgaaggagagaaagaagtgatgaaactctggaatctccat
gtcatgaagcatgggtttattgctgacaatcaaatgaatcatgcctgtatgctgtttgta
gaaaattatggacagaaaataattaagaagaatttatgtcgaaacttcatgcttcatcta
gtcagcatgcatgactttaatcttattagcataatgtcaatagataaagctgttaccaag
ctccgtgaaatgcagcaaaaattagaaaagggggaatctgcttcccctgcaaacgaagaa
ataactgaagaacaaaatgggacagcaaatggatttagtgaaattaactcaaaagagaaa
gctttggaaacagatagtgtctcaggggtttcaaaacagagcaaaaaacaaaaactctga

DBGET integrated database retrieval system