KEGG   Homo sapiens (human): 23518Help
Entry
23518             CDS       T01001                                 

Gene name
R3HDM1, R3HDM
Definition
(RefSeq) R3H domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SUZ R3H
Motif
Other DBs
NCBI-GeneID: 23518
NCBI-ProteinID: NP_056176
HGNC: 9757
Ensembl: ENSG00000048991
Vega: OTTHUMG00000131740
Pharos: Q15032(Tdark)
UniProt: Q15032
Position
2q21.3
AA seq 1099 aa AA seqDB search
MRMSDTVTVKDETATMKDLEAEVKDTTRVENLIKSENYGKILVEKNEHCIENNIDLQRPL
QSFGQTGKRSKSSSKLKLVRSLAVCEESPPPPAPEISQENQEKIQIQLTQSFEKEEKPSK
DEAEKEKASDKLPRKMLSRDSSQEYTDSTGIDLHEFLVNTLKNNPRDRMMLLKLEQEILD
FIGNNESPRKKFPPMTSYHRMLLHRVAAYFGLDHNVDQSGKSVIVNKTSNTRIPDQKFNE
HIKDDKGEDFQKRYILKRDNSSFDKDDNQMRIRLKDDRRSKSIEEREEEYQRARDRIFSQ
DSLCSQENYIIDKRLQDEDASSTQQRRQIFRVNKDASGRSTNSHQSSTENELKYSEPRPW
SSTDSDSSLRNLKPAVTKASSFSGISVLTRGDSSGSSKSIGRLSKTGSESSGSVGSSTGS
LSHIQQPLPGTALSQSSHGAPVVYPTVSTHSSLSFDGGLNGQVASPSTSFFLLPLEAAGI
PPGSILINPQTGQPFINPDGSPVVYNPPMTQQPVRSQVPGPPQPPLPAPPQQPAANHIFS
QDNLGSQFSHMSLARQPSADGSDPHAAMFQSTVVLQSPQQSGYIMTAAPPPHPPPPPPPP
PPPPPLPPGQPVPTAGYPASGHPVSQPVLQQQGYIQQPSPQMPACYCAPGHYHSSQPQYR
PVPSVHYNSHLNQPLPQPAQQTGYQVIPNQQQNYQGIVGVQQPQSQSLVSGQPNSIGNQI
QGVVIPYTSVPTYQVSLPQGSQGIPHQTYQQPVMFPNQSNQGSMPTTGMPVYYSVIPPGQ
QNNLSSSVGYLQHPGSEQVQFPRTTSPCSSQQLQGHQCTAGPPPPPGGGMVMMQLSVPNN
PQSCAHSPPQWKQNKYYCDHQRGQKCVEFSSVDNIVQHSPQLSSPIISPAQSPAPAQLST
LKTVRPSGPPLSIMPQFSRPFVPGQGDSRYPLLGQPLQYNPPAVLHGHIPNQQGQPGSRH
GNRGRRQAKKAASTDLGAGETVVGKVLEITELPDGITRMEAEKLFGELFKIGAKIRWLRD
PQSQPRRHPLCCGSGDNTANPERSKPSDLASTYTVLATFPSISAAQNALKKQINSVNKFK
LRTSKKHYDFHILERASSQ
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtctgatactgttactgtaaaagatgaaactgcaacaatgaaggatttggag
gcagaagtgaaagatacaaccagagttgaaaatcttatcaaatcagaaaactatgggaag
attttggtagagaagaatgaacattgtattgagaacaatatagatttgcagcggccattg
cagtcatttggacagacaggaaaaaggtctaagtcaagctcaaagttaaagctagttcgg
agccttgcagtgtgtgaagaatctccaccaccccctgcaccagagatatcacaggagaac
caggagaaaattcagatccagttaacacaatcatttgagaaagaagagaagccctcaaaa
gatgaagcagaaaaagaaaaggccagtgataagttgcccagaaaaatgttatcaagagat
tccagtcaagaatacactgattcaactggcatagatctacatgaatttttagtaaataca
ttaaaaaacaatcccagggacagaatgatgctgctgaaattggaacaagaaattttagat
ttcattggtaataatgagtctccacgtaaaaaattccccccaatgacatcttaccatagg
atgctattacacagagtagccgcttactttggattagaccacaatgttgatcagagtggg
aagtctgtcatagtaaacaaaactagcaatacaagaatacctgatcagaaatttaatgaa
catattaaggatgataaaggtgaagactttcagaaacgttatatcctcaagagagataac
tctagctttgacaaagatgataaccagatgagaatacgtttgaaagatgacagaagaagc
aaatctatagaagaaagagaagaagagtaccagagagccagagaccgaatattttcccaa
gattccctgtgttcccaagagaattacattattgacaaaagactccaagacgaggatgcc
agtagtacccagcagaggcgccagatatttagagttaataaagatgcttcagggagatct
acaaatagccatcaaagcagcactgagaatgagttgaagtactcggaaccacgaccctgg
agcagcacagattcagacagctctcttcgaaacctgaaacctgctgtaaccaaagccagc
agcttcagtggaatctcagtcctgacaagaggtgatagttctggaagcagcaaaagcata
ggcaggctttcaaaaacaggttctgagtcttctggtagtgtagggtcatctacaggctct
ctttctcacatccagcagcctcttccaggtacagctctcagccagtcttctcatggcgca
cctgtcgtctatccaactgtcagcactcatagttctctttcctttgatggtggcctaaat
gggcaagtcgcatctcctagcactagcttctttttgcttcccttggaagcggcaggcata
ccacctggcagtattctgatcaacccacaaacaggtcagcccttcataaacccagatggg
agtccagttgtgtataatcctcctatgactcaacaaccagttagatcccaagtgcctgga
cctccacagccacctctgccagccccacctcaacaaccagcagctaatcacattttctca
caggataacctagggtctcagtttagccacatgagtcttgctcgccagccatctgctgat
ggttctgaccctcatgccgccatgttccagtccactgtggttcttcagtctccacagcag
tctggttatatcatgacagcagcccctccaccacatcctcctccaccgccaccaccacca
cctcctcctcctcccctaccacctgggcagccagtccctactgctggatatcctgcctct
ggtcatcctgtcagccagcctgtgctccagcagcagggatatattcagcagccatcacca
cagatgccagcctgttattgcgctccaggccactatcactccagccaacctcagtatcgc
ccagtcccttctgttcattacaattcacatctaaaccaaccactgccacaacctgcgcag
cagacaggttatcaagttatacccaaccagcagcaaaactaccaaggaatagttggagtt
cagcaaccccagagtcagagcctagtcagtggccaacccaacagcattggaaatcagatt
caaggagtggtcatcccctatacttcagtgccaacatatcaggtttcactgcctcaaggt
tctcaaggaattccccatcagacttatcaacagcctgttatgttccctaatcagtctaat
caaggatctatgcccacaacaggaatgcctgtttactatagtgtcattccacctggtcaa
caaaacaatttaagctcttcagtaggttacctgcaacatccaggatcagaacaagtacaa
tttcctcgaaccacttcaccatgcagttcccagcagcttcaaggccaccaatgtacagct
ggaccaccaccgccacctggtggggggatggtgatgatgcagctcagtgtaccaaacaat
ccacaatcttgtgcccactcacccccgcagtggaaacaaaacaaatattactgtgatcac
cagagaggacagaagtgtgtagaatttagcagtgtagacaatattgtccagcacagccct
caactcagtagccccattatttcaccagctcagtcgccagcaccagctcagctgtccacc
ctgaaaactgtacgtccctctggaccaccactttccatcatgccccaattttctagacct
tttgtccccgggcaaggagattccaggtatccattacttggccagccactgcagtacaat
cctcctgctgttctgcacggacacattccaaaccaacagggtcagcctggcagcaggcat
ggaaaccgaggaaggagacaagctaaaaaagctgcatccacagaccttggagcaggagaa
acagttgttgggaaggtcttggaaattactgaactaccagatggaataactcgcatggaa
gctgaaaagctttttggggaactctttaaaattggcgccaagatccggtggctccgggac
ccccagtcccaaccacgtcgtcaccccctctgctgtggcagtggggacaacactgccaac
cctgaacgctctaaacccagtgacttggcctccacctacaccgtcttagccacattcccc
tccatttcagctgcacagaatgcactgaagaaacaaattaactcagttaacaagtttaag
ctgagaacaagcaagaagcactatgactttcacattttggaaagggcaagttctcagtaa

DBGET integrated database retrieval system