KEGG   Homo sapiens (human): 245806Help
Entry
245806            CDS       T01001                                 

Gene name
VGLL2, VGL2, VITO1
Definition
(RefSeq) vestigial like family member 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Vg_Tdu
Motif
Other DBs
NCBI-GeneID: 245806
NCBI-ProteinID: NP_872586
OMIM: 609979
HGNC: 20232
Ensembl: ENSG00000170162
Vega: OTTHUMG00000015451
Pharos: Q8N8G2(Tbio)
UniProt: Q8N8G2
Position
6q22.1
AA seq 317 aa AA seqDB search
MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTP
ASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSS
KAPRSSGPWRDCSFPMSQRSFPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPA
ALHGHLHQGATEPWHHAHPHHAHPHHPYALGGALGAQAAPYPRPAAVHEVYAPHFDPRYG
PLLMPAASGRPARLATAPAPAPGSPPCELSGKGEPAGAAWAGPGGPFASPSGDVAQGLGL
SVDSARRYSLCGASLLS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagctgtctggatgttatgtaccaagtctatggtcctccgcagccctacttcgcagcc
gcctacaccccctaccaccagaaactagcctattattccaaaatgcaggaagcgcaggag
tgcaatgccagccccagcagcagtggcagcggcagctcctcattttccagccaaacccca
gccagtataaaagaggaagaaggcagcccagagaaagagcgcccaccagaggcagagtac
atcaactcccgctgcgtcctcttcacttatttccagggggacatcagctccgtggtggat
gaacatttcagcagggccctgagccaacccagcagctactctcctagctgtaccagcagc
aaagcaccaaggagctctgggccctggcgagactgctccttcccgatgagccagcgcagc
ttccccgcctccttctggaatagcgcgtaccaggcgccagtgcccccgccgctgggcagc
cctctggccaccgcgcactcggagctgcccttcgccgccgccgacccctactcgcccgcc
gcgctgcatggccacctgcaccagggcgccacggagccctggcaccacgcgcacccgcac
cacgcgcacccgcatcacccctacgccctgggcggcgccctcggcgcccaggccgccccc
tacccgcgccccgccgccgtgcacgaagtctacgcgccgcacttcgacccgcgctatggg
ccgctgctgatgccagccgcctcggggcgcccggcccgcctcgcaaccgccccggcgccc
gcgcccggcagtcctccctgcgagctctccggcaaaggcgagccggcgggcgccgcgtgg
gccgggcccgggggacccttcgcgagcccctcgggggacgtggcccagggtctgggcctc
agcgtggactcagctcgtcgttattccctctgtggtgcatccctcctgagctga

DBGET integrated database retrieval system