KEGG   Homo sapiens (human): 254042Help
Entry
254042            CDS       T01001                                 

Gene name
METAP1D, MAP_1D, MAP1D, MetAP_1D, Metap1l
Definition
(RefSeq) methionyl aminopeptidase type 1D, mitochondrial
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    254042 (METAP1D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     254042 (METAP1D)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M24
   254042 (METAP1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 254042
NCBI-ProteinID: NP_954697
OMIM: 610267
HGNC: 32583
Ensembl: ENSG00000172878
Vega: OTTHUMG00000132283
Pharos: Q6UB28(Tbio)
UniProt: Q6UB28
Position
2q31.1
AA seq 335 aa AA seqDB search
MAAPSGVHLLVRRGSHRIFSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSS
AHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMT
TEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVT
VYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQ
NGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDA
WTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccagtggcgtccacctgctcgtccgcagaggttctcatagaattttctct
tcaccactcaatcatatctacttacacaagcagtcaagcagtcaacaaagaagaaatttc
ttttttcggagacaaagagatatttcacacagtatagttttgccggctgcagtttcttca
gctcatccggttcctaagcacataaagaagccagactatgtgacgacaggcattgtacca
gactggggagacagcatagaagttaagaatgaagatcagattcaagggcttcatcaggct
tgtcagctggcccgccacgtcctcctcttggctgggaagagtttaaaggttgacatgaca
actgaagagatagatgctcttgttcatcgggaaatcatcagtcataatgcctatccctca
cctctaggctatggaggttttccaaaatctgtttgtacctctgtaaacaacgtgctctgt
catggtattcctgacagtcgacctcttcaggatggagatattatcaacattgatgtcaca
gtctattacaatggctaccatggagacacctctgaaacatttttggtgggcaatgtggac
gaatgtggtaaaaagttagtggaggttgccaggaggtgtagagatgaagcaattgcagct
tgcagagcaggggctcccttctctgtaattggaaacacaatcagccacataactcatcag
aatggttttcaagtctgtccacattttgtgggacatggaataggatcttactttcatgga
catccagaaatttggcatcatgcaaacgacagtgatctacccatggaggagggcatggca
ttcactatagagccaatcatcacggagggatcccctgaatttaaagtcctggaggatgca
tggactgtggtctccctagacaatcaaaggtcggcgcagttcgagcacacggttctgatc
acgtcgaggggcgcgcagatcctgaccaaactaccccatgaggcctga

DBGET integrated database retrieval system