KEGG   Homo sapiens (human): 2623Help
Entry
2623              CDS       T01001                                 

Gene name
GATA1, ERYF1, GATA-1, GF-1, GF1, NF-E1, NFE1, XLANP, XLTDA, XLTT
Definition
(RefSeq) GATA binding protein 1
  KO
K09182  GATA-binding protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00978  Thrombocytopenia (THC)
H01740  Macrothrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2623 (GATA1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    2623 (GATA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATA TF_Zn_Ribbon Zn-ribbon_8 ArfGap
Motif
Other DBs
NCBI-GeneID: 2623
NCBI-ProteinID: NP_002040
OMIM: 305371
HGNC: 4170
Ensembl: ENSG00000102145
Vega: OTTHUMG00000021504
Pharos: P15976(Tbio)
UniProt: P15976
Position
Xp11.23
AA seq 413 aa AA seqDB search
MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAAL
AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQA
VEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPL
NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD
GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGT
AHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggagttccctggcctggggtccctggggacctcagagcccctcccccagtttgtggat
cctgctctggtgtcctccacaccagaatcaggggttttcttcccctctgggcctgagggc
ttggatgcagcagcttcctccactgccccgagcacagccaccgctgcagctgcggcactg
gcctactacagggacgctgaggcctacagacactccccagtctttcaggtgtacccattg
ctcaactgtatggaggggatcccagggggctcaccatatgccggctgggcctacggcaag
acggggctctaccctgcctcaactgtgtgtcccacccgcgaggactctcctccccaggcc
gtggaagatctggatggaaaaggcagcaccagcttcctggagactttgaagacagagcgg
ctgagcccagacctcctgaccctgggacctgcactgccttcatcactccctgtccccaat
agtgcttatgggggccctgacttttccagtaccttcttttctcccaccgggagccccctc
aattcagcagcctattcctctcccaagcttcgtggaactctccccctgcctccctgtgag
gccagggagtgtgtgaactgcggagcaacagccactccactgtggcggagggacaggaca
ggccactacctatgcaacgcctgcggcctctatcacaagatgaatgggcagaacaggccc
ctcatccggcccaagaagcgcctgattgtcagtaaacgggcaggtactcagtgcaccaac
tgccagacgaccaccacgacactgtggcggagaaatgccagtggggatcccgtgtgcaat
gcctgcggcctctactacaagctacaccaggtgaaccggccactgaccatgcggaaggat
ggtattcagactcgaaaccgcaaggcatctggaaaagggaaaaagaaacggggctccagt
ctgggaggcacaggagcagccgaaggaccagctggtggctttatggtggtggctgggggc
agcggtagcgggaattgtggggaggtggcttcaggcctgacactgggccccccaggtact
gcccatctctaccaaggcctgggccctgtggtgctgtcagggcctgttagccacctcatg
cctttccctggacccctactgggctcacccacgggctccttccccacaggccccatgccc
cccaccaccagcactactgtggtggctccgctcagctcatga

DBGET integrated database retrieval system