KEGG   Homo sapiens (human): 2627Help
Entry
2627              CDS       T01001                                 

Gene name
GATA6
Definition
(RefSeq) GATA binding protein 6
  KO
K17897  GATA-binding protein 6
Organism
hsa  Homo sapiens (human)
Disease
H00546  Atrial septal defect
H00547  Atrioventricular septal defect
H00549  Tetralogy of Fallot
H01736  Persistent truncus arteriosus
H02198  Pancreatic agenesis and congenital heart disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2627 (GATA6)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 GATA-factors
    2627 (GATA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon Prim_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 2627
NCBI-ProteinID: NP_005248
OMIM: 601656
HGNC: 4174
Ensembl: ENSG00000141448
Vega: OTTHUMG00000131767
Pharos: Q92908(Tbio)
UniProt: Q92908
Position
18q11.2
AA seq 595 aa AA seqDB search
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDTEAAAGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGSGGG
AAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSL
AAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLH
SLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRP
LAMKKEGIQTRKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASG
AGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggccttgactgacggcggctggtgcttgccgaagcgcttcggggccgcgggtgcggac
gccagcgactccagagcctttccagcgcgggagccctccacgccgccttcccccatctct
tcctcgtcctcctcctgctcccggggcggagagcggggccccggcggcgccagcaactgc
gggacgcctcagctcgacacggaggcggcggccggacccccggcccgctcgctgctgctc
agttcctacgcttcgcatcccttcggggctccccacggaccttcggcgcctggggtcgcg
ggccccgggggcaacctgtcgagctgggaggacttgctgctgttcactgacctcgaccaa
gccgcgaccgccagcaagctgctgtggtccagccgcggcgccaagctgagccccttcgca
cccgagcagccggaggagatgtaccagaccctcgccgctctctccagccagggtccggcc
gcctacgacggcgcgcccggcggcttcgtgcactctgcggccgcggcggcagcagccgcg
gcggcggccagctccccggtctacgtgcccaccacccgcgtgggttccatgctgcccggc
ctaccgtaccacctgcaggggtcgggcagtgggccagccaaccacgcgggcggcgcgggc
gcgcaccccggctggcctcaggcctcggccgacagccctccatacggcagcggaggcggc
gcggctggcggcggggccgcggggcctggcggcgctggctcagccgcggcgcacgtctcg
gcgcgcttcccctactctcccagcccgcccatggccaacggcgccgcgcgggagccggga
ggctacgcggcggcgggcagtgggggcgcgggaggcgtgagcggcggcggcagtagcctg
gcggccatgggcggccgcgagccccagtacagctcgctgtcggccgcgcggccgctgaac
gggacgtaccaccaccaccaccaccaccaccaccaccatccgagcccctactcgccctac
gtgggggcgccactgacgcctgcctggcccgccggacccttcgagaccccggtgctgcac
agcctgcagagccgcgccggagccccgctcccggtgccccggggtcccagtgcagacctg
ctggaggacctgtccgagagccgcgagtgcgtgaactgcggctccatccagacgccgctg
tggcggcgggacggcaccggccactacctgtgcaacgcctgcgggctctacagcaagatg
aacggcctcagccggcccctcatcaagccgcagaagcgcgtgccttcatcacggcggctt
ggattgtcctgtgccaactgtcacaccacaactaccaccttatggcgcagaaacgccgag
ggtgaacccgtgtgcaatgcttgtggactctacatgaaactccatggggtgcccagacca
cttgctatgaaaaaagagggaattcaaaccaggaaacgaaaacctaagaacataaataaa
tcaaagacttgctctggtaatagcaataattccattcccatgactccaacttccacctct
tctaactcagatgattgcagcaaaaatacttcccccacaacacaacctacagcctcaggg
gcgggtgccccggtgatgactggtgcgggagagagcaccaatcccgagaacagcgagctc
aagtattcgggtcaagatgggctctacataggcgtcagtctcgcctcgccggccgaagtc
acgtcctccgtgcgaccggattcctggtgcgccctggccctggcctga

DBGET integrated database retrieval system