KEGG   Homo sapiens (human): 27
Entry
27                CDS       T01001                                 
Symbol
ABL2, ABLL, ARG
Name
(RefSeq) ABL proto-oncogene 2, non-receptor tyrosine kinase
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05416  Viral myocarditis
Network
nt06223  TNF signaling
  Element
N01411  Metals to NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    27 (ABL2)
   04014 Ras signaling pathway
    27 (ABL2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    27 (ABL2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    27 (ABL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    27 (ABL2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     27 (ABL2)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  ABL family
   27 (ABL2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 NHS Haspin_kinase SH3_6 ABC1 RGS12_us1
Other DBs
NCBI-GeneID: 27
NCBI-ProteinID: NP_009298
OMIM: 164690
HGNC: 77
Ensembl: ENSG00000143322
Pharos: P42684(Tchem)
UniProt: P42684
Structure
Position
1:complement(179099330..179229677)
AA seq 1182 aa
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVE
DGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
NSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGG
SFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPR
SNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEES
AAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLG
MAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKL
LSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQE
GGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKIS
ADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAV
SKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR
NT seq 3549 nt   +upstreamnt  +downstreamnt
atggggcagcaggtgggccgcgtcggggaagctccggggctccagcagcctcagccccgc
gggatccggggcagcagtgcagccaggccctccggccgcaggcgggacccggcggggcgc
accacagagaccggcttcaatatcttcacccagcatgatcactttgccagctgtgtggag
gatggatttgagggagacaagactggaggcagtagtccagaagctttgcatcgtccctat
ggttgtgatgttgaaccccaggcactaaatgaggctatcaggtggagctccaaggagaac
ttgctcggagccactgagagtgaccctaatctcttcgttgcactttatgattttgtagca
agtggtgataacacactcagcatcactaaaggtgaaaagctacgagtccttggttacaac
cagaatggtgagtggagtgaagttcgctctaagaatgggcagggctgggtgccaagcaac
tacatcaccccagtgaacagcctggaaaaacactcctggtaccatggacctgtgtcacgc
agtgcagctgagtatctgctcagcagtctaatcaatggcagcttcctggtgcgagaaagt
gagagtagccctgggcagctgtccatctcgctcaggtacgagggacgtgtgtatcactac
aggatcaataccactgcagatggcaaggtgtatgtgactgctgagagccgcttcagcacc
ttggcagagcttgtacaccatcactccacagtggctgatgggctggtgacaacattacac
tacccagcacccaagtgtaataagcctacagtctatggtgtgtcccccatccacgacaaa
tgggaaatggagcgaacagatattaccatgaagcacaaacttgggggcggtcagtatgga
gaggtttacgttggcgtctggaagaaatacagccttacagttgctgtgaaaacattgaag
gaagataccatggaggtagaagaattcctgaaagaagctgcagtaatgaaggaaatcaag
catcctaatctggtacaacttttaggtgtgtgtactttggagccaccattttacattgtg
actgaatacatgccatacgggaatttgctggattacctccgagaatgcaaccgagaagag
gtgactgcagttgtgctgctctacatggccactcagatttcttctgcaatggagtactta
gagaagaagaatttcatccatagagatcttgcagctcgtaactgcctagtgggagaaaac
catgtggtaaaagtggctgactttggcttaagtagattgatgactggagacacttatact
gctcatgctggagccaaatttcctattaagtggacagcaccagagagtcttgcctacaat
accttctcaattaaatctgacgtctgggcttttggggtattgttgtgggaaattgctacc
tatggaatgtcaccatatccaggtattgacctgtctcaggtctatgacctactagaaaaa
ggatatcgaatggaacagcctgagggatgcccccctaaggtttatgaacttatgagagca
tgctggaagtggagccctgccgataggccctcttttgctgaaacacaccaagcttttgaa
accatgttccatgactccagcatttctgaagaggtagctgaggagcttgggagagccgcc
tcctcgtcatctgttgttccatacctgccccggctacctatacttccttccaagactcgg
acactgaagaaacaggtggagaacaaggagaacattgaaggggcacaagatgccacagaa
aattctgcttccagtttagcaccagggttcatcagaggtgcacaggcctctagtggatcc
ccagcactgcctcgaaagcaaagagacaagtcacccagcagcctcttggaagatgccaaa
gagacatgcttcaccagggataggaaggggggcttcttcagctccttcatgaagaagaga
aatgctcctacaccccccaaacgcagcagctccttccgagaaatggagaatcagccccat
aagaaatacgaactcacgggtaacttctcatctgttgcttctctacagcatgctgatggg
ttctctttcactcctgcccagcaagaggcgaatctggtgccacccaagtgctatgggggg
agctttgcacagaggaacctctgtaatgacgacggtggtgggggtgggggcagtggcact
gctgggggtgggtggtctggcatcacaggcttctttacaccacgcttaatcaaaaagaca
ctgggcttacgagcaggtaaacccacagccagtgatgacacttccaagccttttccaagg
tcaaactctacatcttccatgtcctcagggcttccagagcaggataggatggcaatgacc
cttcccaggaactgccagaggtccaaactccagctggaaaggacagtgtccacctcttct
cagccagaagagaatgtggacagggccaatgacatgcttccaaaaaaatcagaggaaagt
gctgctccaagcagggagagaccaaaagccaagttattgcccagaggagccacagctctt
cctctcagaacaccctctggggatctagccattacagagaaggaccctccaggggtggga
gtggctggagtggcagctgcccccaagggtaaagagaagaatggtggggcacgacttggg
atggctggagttccagaggatggagagcagccgggctggccttctccagccaaggctgcc
cccgtcctcccaaccactcacaaccacaaagtgccagtccttatctcacccactctgaaa
cacactccagctgacgtgcagctcattggcacagactctcaggggaataaattcaagctc
ttatctgagcatcaggtcacatcctctggagacaaggaccgaccccgacgggtaaaacca
aagtgtgccccacccccaccaccagtgatgagactactgcagcatccgtccatctgctca
gaccctacagaagagccaactgccctaactgcaggacagtccacatcagaaacacaggaa
ggaggaaagaaggcagctctgggcgcagtgcccatcagtgggaaagctgggaggccagtg
atgcctccacctcaagtgcctctgcccacatcttccatctcgccagccaaaatggccaat
ggcacagcaggtactaaagtggctctgagaaaaaccaaacaggccgctgagaaaatctca
gcagacaaaatcagcaaagaggccctgctggaatgtgctgacctactgtccagtgcactc
acggaacctgtgcccaacagccagctggtagacactggacaccagctgcttgactactgc
tcaggctatgtggactgcatccctcaaactcgcaacaaatttgccttccgagaggctgtg
agcaaactggaactcagcctgcaggagctacaggtttcttcagcagctgctggtgtgccc
gggacaaaccctgtccttaataacttattgtcatgtgtacaggaaatcagtgatgtggtg
cagaggtag

DBGET integrated database retrieval system