KEGG   Homo sapiens (human): 285834Help
Entry
285834            CDS       T01001                                 

Gene name
HCG22, PBMUCL2
Definition
(RefSeq) HLA complex group 22 (gene/pseudogene)
Organism
hsa  Homo sapiens (human)
Disease
H01713  Diffuse panbronchiolitis
SSDB OrthologParalogGFIT
Motif
Pfam: Mucin-like DUF3672
Motif
Other DBs
NCBI-GeneID: 285834
NCBI-ProteinID: NP_001335178
OMIM: 613918
HGNC: 27780
Ensembl: ENSG00000228789
UniProt: E2RYF7
Position
6p21.33
AA seq 251 aa AA seqDB search
MPRYVPLLLLLLLLRCSERGGGVNFGEKDAKVPGTWRDGVRVPGEGASWDSDRASPERRY
GIVGLSQSISTKHPETSPKDSRIRENDVTADGRTTEDHITADPGTTEDSVTADPGTTEDN
VTVDPGTTEGSVTADPATTKDYVSADPGTTKDSVTADPGTTENFVTADPGTTKDSITADP
RTTEDSVTADPGTTKHSITVDPGTTEDSVTADPGTTKHSITADPGTTEDSVTADPGTTED
ETTKHGDTHLL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctacgtcccccttctgctgctcctgcttctcctgaggtgttcagaacggggt
ggaggagttaattttggtgagaaggatgcaaaagtccccgggacctggagagatggagtc
agggtccctggagaaggagcctcttgggactcagacagggccagtcccgagcgaaggtac
ggaatagtaggactaagccaaagcatttccactaagcacccagagaccagccctaaagac
tcaagaataagagaaaatgatgtaactgcagatggaaggaccactgaggaccacatcact
gcagacccagggaccaccgaggactctgtcactgcagacccagggaccactgaggacaat
gtgactgtggacccagggaccaccgagggctctgtcactgcagacccagcgaccaccaag
gactatgtgtctgcagacccagggaccaccaaggattctgtcactgcagacccagggacc
actgagaactttgtcactgcagacccagggaccaccaaggactccatcactgcagaccca
aggaccacagaggactccgtcactgcagacccagggaccaccaaacactccatcactgta
gacccagggaccactgaggactctgtcactgcagacccagggaccaccaaacactccatc
actgcagacccagggaccaccgaggactccgtcactgcagacccagggaccacagaagat
gaaaccactaaacatggtgacactcaccttctgtga

DBGET integrated database retrieval system