KEGG   Homo sapiens (human): 286826
Entry
286826            CDS       T01001                                 
Symbol
LIN9, BARA, BARPsv, Lin-9, TGS, TGS1, TGS2
Name
(RefSeq) lin-9 DREAM MuvB core complex component
  KO
K21773  protein lin-9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    286826 (LIN9)
SSDB
Motif
Pfam: LIN9_C DIRP DUF2664 Rotavirus_VP1 FTA4
Other DBs
NCBI-GeneID: 286826
NCBI-ProteinID: NP_775106
OMIM: 609375
HGNC: 30830
Ensembl: ENSG00000183814
Pharos: Q5TKA1(Tbio)
UniProt: Q5TKA1
Structure
Position
1:complement(226231149..226309767)
AA seq 558 aa
MHRGGQPLKKRRGSFKMAELDQLPDESSSAKALVSLKEGSLSNTWNEKYSSLQKTPVWKG
RNTSSAVEMPFRNSKRSRLFSDEDDRQINTRSPKRNQRVAMVPQKFTATMSTPDKKASQK
IGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWG
KIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGT
KVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAA
FGQKQRPSRFFMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTETLGGFPVEFLI
QVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNK
VLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLI
SRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSG
LSQMGNLHAFAANNTNRD
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcaccgcggcgggcagcctttgaaaaagcggcgcggctcgttcaagatggcggagctc
gaccagttgcctgacgagagctcttcagcaaaagcccttgtcagtttaaaagaaggaagc
ttatctaacacgtggaatgaaaagtacagttctttacagaaaacacctgtttggaaaggc
aggaatacaagctctgctgtggaaatgcctttcagaaattcaaaacgaagtcgacttttt
tctgatgaagatgataggcaaataaatacaaggtcacctaaaagaaaccagagggttgca
atggttccacagaaatttacagcaacaatgtcaacaccagataagaaagcttcacagaag
attggttttcgattacgtaatctgctcaagcttcctaaagcacataaatggtgtatatac
gagtggttctattcaaatatagataaaccactttttgaaggtgataatgacttctgtgta
tgtctaaaggaatcttttcctaatttgaaaacaagaaagttaacaagagtagaatgggga
aaaattcggcggcttatgggaaaaccacggagatgttcttctgcattttttgaggaagag
agatcagcattaaaacagaaacggcagaaaataaggctcttacaacaaaggaaagttgca
gatgtttcacaattcaaagatctcccagatgaaattcctttgcctctggttattggaacg
aaagttacagcacgattacgtggtgttcatgatggtttgttcactggacaaatagatgct
gtggatactcttaatgctacttatagagtaacttttgataggacagggcttggaacccat
accatccctgactatgaagttctcagtaatgaacctcatgagacaatgccaattgctgcc
tttggacaaaaacagcggccttctcgattttttatgaccccaccacggttacattatact
cctcctctccagtcaccaattatagataatgatcctttattaggacagtcgccgtggaga
agtaaaatttctggctctgacactgaaacattaggtggttttccagtagaatttcttatc
caagtgaccagattatcaaaaattctcatgattaaaaaggaacatatcaagaaattaagg
gaaatgaacacagaagcagaaaaattgaaatcatattccatgcccatcagcattgaattt
cagcggagatatgcaacaattgttctggagcttgaacagctgaacaaggacctaaacaaa
gttttgcataaagttcaacagtattgctatgagcttgctccagaccaggggctccagcct
gcagatcagccaacagatatgagacgcaggtgtgaggaagaagcacaggaaattgttcgg
catgcaaattcctcaacaggacagccctgcgttgaaaatgaaaatctgacagacttaatt
tccaggcttacagctattttgttacaaattaagtgtctagcagaaggaggagacctgaat
tcctttgaattcaaatcacttacagactcattaaatgatatcaagagtacaatagacgct
tctaatatcagttgctttcagaataatgtagaaatccatgttgcacatattcagagtggc
ctgagccagatgggaaacttacatgcctttgcagcaaataacaccaacagagactga

DBGET integrated database retrieval system