KEGG   Homo sapiens (human): 29920
Entry
29920             CDS       T01001                                 
Symbol
PYCR2, HLD10, P5CR2
Name
(RefSeq) pyrroline-5-carboxylate reductase 2
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
Module
hsa_M00015  Proline biosynthesis, glutamate => proline
Disease
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    29920 (PYCR2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     29920 (PYCR2)
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_Gly3P_dh_N ApbA 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 29920
NCBI-ProteinID: NP_037460
OMIM: 616406
HGNC: 30262
Ensembl: ENSG00000143811
Pharos: Q96C36(Tbio)
UniProt: Q96C36 A0A0S2Z5U6
Structure
Position
1:complement(225919878..225924250)
AA seq 320 aa
MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETV
KHSDVLFLAVKPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRC
MTNTPVVVQEGATVYATGTHALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFMALDALADGGVKMGLPRRLAIQLGAQALLGAAKMLLDSEQHPCQLKDNVCSPGGATIH
ALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTL
TPSSPGKLLTRSLALGGKKD
NT seq 963 nt   +upstreamnt  +downstreamnt
atgagcgtgggcttcatcggggccggccagctggcctatgctctggcgcggggcttcacg
gccgcaggcatcctgtcggctcacaagataatagccagctccccagaaatgaacctgccc
acggtgtccgcgctcaggaagatgggtgtgaacctgacacgcagcaacaaggagacggtg
aagcacagcgacgtcctgtttctggctgtgaagccacatatcatccccttcatcctggat
gagattggggccgacgtgcaagccagacacatcgtggtctcctgtgcggctggtgtcacc
atcagctctgtggagaagaagctgatggcattccagccagcccccaaagtgattcgctgc
atgaccaacacacctgtggtagtgcaggaaggcgctacagtgtacgccacgggcacccat
gccctggtggaggatgggcagctcctggagcagctcatgagcagcgtgggcttctgcact
gaggtggaagaggacctcatcgatgccgtcacggggctcagtggcagcgggcctgcctat
gcattcatggctctggacgcattggctgatggtggggtgaagatgggtttgccacggcgc
ctggcaatccaactcggggcccaggctttgctgggagctgccaagatgctgctggactcg
gagcagcatccatgccagcttaaggacaatgtctgctcccctgggggagccaccatccac
gccctgcactttctagagagtgggggcttccgctctctgctcatcaatgcagttgaggcc
tcctgtatccgaacacgagagctacagtccatggccgaccaagaaaagatctccccagct
gcccttaagaagaccctcttagacagagtgaagctggaatcccccacagtctccacactg
accccctccagcccagggaagctcctcacaagaagcctggccctgggaggcaagaaggac
taa

DBGET integrated database retrieval system