KEGG   Homo sapiens (human): 3001
Entry
3001              CDS       T01001                                 
Symbol
GZMA, CTLA3, HFSP
Name
(RefSeq) granzyme A
  KO
K01352  granzyme A [EC:3.4.21.78]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3001 (GZMA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3001 (GZMA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.78  granzyme A
     3001 (GZMA)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   3001 (GZMA)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 3001
NCBI-ProteinID: NP_006135
OMIM: 140050
HGNC: 4708
Ensembl: ENSG00000145649
Pharos: P12544(Tbio)
UniProt: P12544
Structure
Position
5:55102646..55110252
AA seq 262 aa
MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIA
KDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQL
MEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCN
DRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGP
GVYILLSKKHLNWIIMTIKGAV
NT seq 789 nt   +upstreamnt  +downstreamnt
atgaggaactcctatagatttctggcatcctctctctcagttgtcgtttctctcctgcta
attcctgaagatgtctgtgaaaaaattattggaggaaatgaagtaactcctcattcaaga
ccctacatggtcctacttagtcttgacagaaaaaccatctgtgctggggctttgattgca
aaagactgggtgttgactgcagctcactgtaacttgaacaaaaggtcccaggtcattctt
ggggctcactcaataaccagggaagagccaacaaaacagataatgcttgttaagaaagag
tttccctatccatgctatgacccagccacacgcgaaggtgaccttaaacttttacagctg
atggaaaaagcaaaaattaacaaatatgtgactatccttcatctacctaaaaagggggac
gatgtgaaaccaggaaccatgtgccaagttgcagggtggggcaggactcacaatagtgca
tcttggtccgatactctgagagaagtcaatatcaccatcatagacagaaaagtctgcaat
gatcgaaatcactataattttaaccctgtgattggaatgaatatggtttgtgctggaagc
ctccgaggtggaagagactcgtgcaatggagattctggaagccctttgttgtgcgagggt
gttttccgaggggtcacttcctttggccttgaaaataaatgcggagaccctcgtgggcct
ggtgtctatattcttctctcaaagaaacacctcaactggataattatgactatcaaggga
gcagtttaa

DBGET integrated database retrieval system