KEGG   Homo sapiens (human): 3003
Entry
3003              CDS       T01001                                 
Symbol
GZMK, TRYP2
Name
(RefSeq) granzyme K
  KO
K08663  granzyme K [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3003 (GZMK)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     3003 (GZMK)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   3003 (GZMK)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 3003
NCBI-ProteinID: NP_002095
OMIM: 600784
HGNC: 4711
Ensembl: ENSG00000113088
Pharos: P49863(Tbio)
UniProt: P49863
Structure
Position
5:55024256..55034570
AA seq 264 aa
MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQ
WVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLV
KLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKL
CNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKP
GIYTLLTKKYQTWIKSNLVPPHTN
NT seq 795 nt   +upstreamnt  +downstreamnt
atgactaagttttcttccttttctctgtttttcctaatagttggggcttatatgactcat
gtgtgtttcaatatggaaattattggagggaaagaagtgtcacctcattccaggccattt
atggcctccatccagtatggcggacatcacgtttgtggaggtgttctgattgatccacag
tgggtgctgacagcagcccactgccaatatcggtttaccaaaggccagtctcccactgtg
gttttaggcgcacactctctctcaaagaatgaggcctccaaacaaacactggagatcaaa
aaatttataccattctcaagagttacatcagatcctcaatcaaatgatatcatgctggtt
aagcttcaaacagccgcaaaactcaataaacatgtcaagatgctccacataagatccaaa
acctctcttagatctggaaccaaatgcaaggttactggctggggagccaccgatccagat
tcattaagaccttctgacaccctgcgagaagtcactgttactgtcctaagtcgaaaactt
tgcaacagccaaagttactacaacggcgacccttttatcaccaaagacatggtctgtgca
ggagatgccaaaggccagaaggattcctgtaagggtgactcagggggccccttgatctgt
aaaggtgtcttccacgctatagtctctggaggtcatgaatgtggtgttgccacaaagcct
ggaatctacaccctgttaaccaagaaataccagacttggatcaaaagcaaccttgtcccg
cctcatacaaattaa

DBGET integrated database retrieval system