KEGG   Homo sapiens (human): 3066Help
Entry
3066              CDS       T01001                                 

Gene name
HDAC2, HD2, RPD3, YAF1
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04213  Longevity regulating pathway - multiple species
hsa04330  Notch signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05016  Huntington's disease
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05220  Chronic myeloid leukemia
Network
N00118  TEL-AML1 fusion to transcriptional repression
Drug target
Belinostat: D08870
Entinostat: D09338
Mocetinostat (DG01404): D09357 D09641
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    3066 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    3066 (HDAC2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    3066 (HDAC2)
  Aging
   04213 Longevity regulating pathway - multiple species
    3066 (HDAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3066 (HDAC2)
   05202 Transcriptional misregulation in cancers
    3066 (HDAC2)
   05203 Viral carcinogenesis
    3066 (HDAC2)
   05220 Chronic myeloid leukemia
    3066 (HDAC2)
  Neurodegenerative diseases
   05016 Huntington's disease
    3066 (HDAC2)
  Substance dependence
   05034 Alcoholism
    3066 (HDAC2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    3066 (HDAC2)
   05165 Human papillomavirus infection
    3066 (HDAC2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     3066 (HDAC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     3066 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     3066 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    3066 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    3066 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 3066
NCBI-ProteinID: NP_001518
OMIM: 605164
HGNC: 4853
Ensembl: ENSG00000196591
Vega: OTTHUMG00000015411
Pharos: Q92769(Tclin)
UniProt: Q92769
Structure
PDB: 

Position
6q21
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaaaaaaaaagtctgctactactacgacggtgatatt
ggaaattattattatggacagggtcatcccatgaagcctcatagaatccgcatgacccat
aacttgctgttaaattatggcttatacagaaaaatggaaatatataggccccataaagcc
actgccgaagaaatgacaaaatatcacagtgatgagtatatcaaatttctacggtcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgtccagtgtttgatggactctttgagttttgtcagctctcaactggcggttcagttgct
ggagctgtgaagttaaaccgacaacagactgatatggctgttaattgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttacgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatatagatattcatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgacggtatcattccat
aaatatggggaatactttcctggcacaggagacttgagggatattggtgctggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgagtcatatgggcag
atatttaagcctattatctcaaaggtgatggagatgtatcaacctagtgctgtggtatta
cagtgtggtgcagactcattatctggtgatagactgggttgtttcaatctaacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaacttttaacttaccattactgatgcttgga
ggaggtggctacacaatccgtaatgttgctcgatgttggacatatgagactgcagttgcc
cttgattgtgagattcccaatgagttgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttgtttgaaaatttgcgcatgttacctcatgcacctggtgtc
cagatgcaagctattccagaagatgctgttcatgaagacagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaagcggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgaagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagataagaaagaaacagaggacaaaaaaacagac
gttaaggaagaagataaatccaaggacaacagtggtgaaaaaacagataccaaaggaacc
aaatcagaacagctcagcaacccctga

DBGET integrated database retrieval system